prospec

WISP1 Human

  • Name
  • Description
  • Pricings
  • Quantity
  • WISP1 Human
  • WNT1 Inducible Signaling Pathway Protein 1 Human Recombinant
  • Shipped at Room temp.

Catalogue number

CYT-1084

Synonyms

WNT1 Inducible Signaling Pathway Protein 1, CCN Family Member 4, CCN4, Wnt-1 Inducible, Signaling Pathway Protein 1, WNT1 Induced Secreted Protein 1, Wnt-1-Induced Secreted Protein, CTC-458A3.8, WISP1tc, WISP1c, WISP1i, WISP-1, WISP1.

Introduction

WISP1 is a part of a family of cysteine-rich, glycosylated signaling proteins that mediate varied developmental processes. WISP1 is a Downstream regulator in the Wnt/Frizzled-signaling pathway and is linked with cell survival.WISP1weakens p53-mediated apoptosis in response to DNA damage through activation of AKT kinase and up-regulates the anti-apoptotic Bcl-X(L) protein.

Description

WISP1 Human Recombinant produced in Mouse myeloma cell line is a single, glycosylated polypeptide chain containing 355 amino acids (Thr23- Asn367), having a molecular mass of 39.3kDa and fused to a 10 aa His Tag.

The WISP1 is purified by proprietary chromatographic techniques.

Source

HEK293 Cells.

Physical Appearance

Sterile Filtered White lyophilized (freeze-dried) powder.

Formulation

WISP1 protein was lyophilized from a 0.2µm filtered solution in PBS.

Solubility

It is recommended to add deionized water to prepare a working stock solution of approximately 0.5mg/ml and let the lyophilized pellet dissolve completely.

Stability

Store lyophilized protein at -20°C. Aliquot the product after reconstitution to avoid repeated freezing/thawing cycles. Reconstituted protein can be stored at 4°C for a limited period of time; it does not show any change after two weeks at 4°C.

Purity

Greater than 95.0% as determined by SDS-PAGE. 

Amino acid sequence

TALSPAPTTMDFTPAPLEDTSSRPQFCKWPCECPPSPPRCPLGVSLITDGCECCKMCAQQLGDNCTEAAICDPHRG

LYCDYSGDRPRYAIGVCAQVVGVGCVLDGVRYNNGQSFQPNCKYNCTCIDGAVGCTPLCLRVRPPRLWCPHPRR

VSIPGHCCEQWVCEDDAKRPRKTAPRDTGAFDAVGEVEAWHRNCIAYTSPWSPCSTSCGLGVSTRISNVNAQCW

PEQESRLCNLRPCDVDIHTLIKAGKKCLAVYQPEASMNFTLAGCISTRSYQPKYCGVCMDNRCCIPYKSKTIDVSFQC

PDGLGFSRQVLWINACFCNLSCRNPNDIFADLESYPDFSEIANHHHHHHHHHH.

Safety Data Sheet

Usage

Prospec's products are furnished for LABORATORY RESEARCH USE ONLY. They may not be used as drugs, agricultural or pesticidal products, food additives or household chemicals.
Back to Top