- Name
 - Description
 - Cat#
 - Pricings
 - Quantity
 
Catalogue number
HBS-885
Introduction
HBsAg is the surface antigenof the Hepatitis-B-Virus (HBV). The capsidof a virus has different surface proteins from the rest of the virus. The antigen is a protein that binds specifically on one of these surface proteins. It is commonly referred to as the Australian Antigen. 
                                Description
HbsAg subtype adw2 produced in E.Coli, is a single, non-glycosylated, polypeptide chain containing 226 amino acids and having a molecular weight of approximately 23.0kDa. HBsAg adw2 migrates on SDS-PAGE as a 23kDa monomer band with minor amounts of dimer (46kDa) and trimer (69kDa) forms.
The HBsAg is fused to a 6 His tag on C-terminus and purified by proprietary chromatographic techniques.
                                The HBsAg is fused to a 6 His tag on C-terminus and purified by proprietary chromatographic techniques.
Source
Escherichia Coli.
                                Physical Appearance
Sterile filtered colorless solution.
                                Formulation
Sterile filtered solution containing 50mM potassium phosphate.
Stability
Store at 4°C if entire vial will be used within 2-4 weeks. Store, frozen at -20°C for longer periods of time.
For long term storage it is recommended to add a carrier protein (0.1% HSA or BSA).
Avoid multiple freeze-thaw cycles.
For long term storage it is recommended to add a carrier protein (0.1% HSA or BSA).
Avoid multiple freeze-thaw cycles.
Safety Data Sheet
Amino acid sequence
MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGSPVCLGQNSQSPTSNH
SPTSCPPICPGYRWMCLRRFIIFLFILLLCLIFLLVLLDYQGMLPVCPLIPGSTTTSTGP
CKTCTTPAQGNSMFPSCCCTKPTDGNCTCIPIPSSWAFAKYLWEWASVRFSWLSLLVPFV
QWFVGLSPTVWLSAIWMMWYWGPSLYSIVSPFIPLLPIFFCLWVYI
Purity
Greater than 90.0% as determined by SDS-PAGE. 
                                Usage
ProSpec's products are furnished for LABORATORY RESEARCH USE ONLY. The product may not be used as drugs, agricultural or pesticidal products, food additives or household chemicals.