prospec

WNV Pre-M

  • Name
  • Description
  • Pricings
  • Quantity
  • WNV Pre-M
  • West Nile Virus Pre-M Recombinant
  • Shipped with Ice Packs

Catalogue number

WNV-002

Introduction

West Nile virus (WNV) is a virus of the family Flaviviridae part of the Japanese encephalitis (JE) antigenic complex of viruses. Image reconstructions and cryoelectron microscopyreveal a 45-50 nm virion covered with a relatively smooth proteinsurface. This structure is similar to virus; both belong to the genus flavivirus within the family Flaviviridae. WNV is a positive-sense, single strand of RNA, it is between 11,000 and 12,000 nucleotides long which encode seven non-structural proteins and three structural proteins. The RNA strand is held within a nucleocapsid formed from 12 kDaprotein blocks; the capsid is contained within a host-derived membrane altered by two viral glycoproteins.

Description

The E.Coli derived 20kda recombinant protein contains the West-Nile N-Terminal Pre-M Virus immunodominant regions. The protein is fused with 6xHis tag.

Source

Escherichia Coli.

Purification Method

Purified by proprietary chromatographic technique.

Purity

Protein is >95% pure as determined by SDS-PAGE.

Formulation

20mM phosphate buffer pH 7.5.

Stability

WNV Pre-M although stable at 4°C for 1 week, should be stored below -18°C.
Please prevent freeze thaw cycles.

Specificity

Immunoreactive with sera of West Nile virus infected individuals.

Applications

Antigen in ELISA and Western blots, excellent antigen for detection of West-Nile virus with minimal specificity problems.

Amino acid sequence

MVTLSNFQGKVMMTVNATDVTDVITIPTAAGKNLCIVRA MDVGYLCEDTITYECPVLAAGNDPEDIDCWCTKSSVYVR
YGRCTKTRHSRRSRRSLTVQTHGESTLANKKGAWLDSTK
ATRYLVKTESWILRNPGYALE.

Usage

ProSpec's products are furnished for LABORATORY RESEARCH USE ONLY.They may not be used as drugs,agricultural or pesticidal products, food additives or household chemicals.
Back to Top