prospec

Protein G

  • Name
  • Description
  • Pricings
  • Quantity
  • Protein G
  • Protein G Recombinant
  • Shipped at Room temp.

Catalogue number

PRO-402

Description

The Protein G is a single, non-glycosylated protein contains 200 amino acids having a molecular mass of 21.8kDa. The Protein-G migrates on SDS-PAGE around 32kDa.

Source

Escherichia Coli.

Physical Appearance

Sterile Filtered White lyophilized (freeze-dried) powder.

Formulation

Lyophilized white powder containing no additives.

Solubility

Reconstitution with deionized water or PBS.

Stability

Lyophilized Recombinant Protein G although stable at room temperature for 3 weeks, should be stored desiccated below -18°C. Upon reconstitution Protein G should be stored at 4°C between 2-7 days and for future use below -18°C.
Please prevent freeze-thaw cycles.

Purity

>96% as determined by SDS-PAGE and RP-HPLC.

Amino acid sequence

LPKTDTYKLILNGKTLKGETTTEAVDAATAEKVFKQYANDNGVDGEWTYDDAT KTFTVTEKPEVIDASELTPAVTTYKLVINGKTLKGETTTEAVDAATAEKVFK QYANDNGVDGEWTYDDATKTFTVTEKPEVIDASELTPAVTTYKLVINGKTL KGETTTKAVDAETAEKAFKQYANDNGVDGVWTYDDATKTFTVTE.

Specificity

1. IgG Binding activity Under optimal conditions: 1 mg protein G will bind ~5 mg. human IgG at pH 5-6.
2. IgG Binding Sites: 3 sites.
3. Isoelectric Point: 4.55.
4. Binds with greater affinity to most mammalian immunoglobulins than Protein A, including human IgG3 and rat IgG2a.
5. Does not bind to human IgM, IgD and IgA.

Usage

ProSpec's products are furnished for LABORATORY RESEARCH USE ONLY. The product may not be used as drugs, agricultural or pesticidal products, food additives or household chemicals.
Back to Top