prospec

Omp Pylori

  • Name
  • Description
  • Pricings
  • Quantity
  • Omp Pylori
  • Helicobacter Pylori Outer Membrane Protein Recombinant
  • Shipped with Ice Packs

Catalogue number

PRO-369

Introduction

Helicobacter pylori, a Gram-negative, microaerophilic bacterium that populates in the stomach, predominantly at the antrum. Helicobacter pylori causes a chronic inflammation of the mucoid lining of stomach and is highly related to the growth of duodenal and gastric ulcers and stomach cancer. Over 50% of the world's population harbor H. pylori in their upper gastrointestinal tract, infection is more prevalent in developing countries. Thus far, no ideal target H. pylori antigen has been developed for the diagnostic purpose. 23 kDa H. pylori outer membrane protein was identified with a good sensitivity and coverage in the diagnosis of H. pylori infection.

Description

Omp Pylori recombinant antigen is produced in E. coli expressing the H. pylori outer membrane protein having the Mw of 23 kDa. Omp Pylori recombinant antigen is well recognized by specific IgG and IgM from H. pylori infected patients.

Source

E.Coli

Purification Method

Purified by proprietary chromatographic technique.

Physical Appearance

Sterile filtered liquid formulation.

Formulation

The Omp Pylori recombinant protein is formulated in 1xPBS pH 7.4.

Stability

Omp Pylori although stable at 4°C for 1 week, should be stored below -18°C.
Please prevent freeze thaw cycles.

Purity

Greater than 95% pure as determined by 12% PAGE (Coomassie staining).

Amino acid sequence

MLVTKLAPDFKAPAVLGNNEVDEHFELSKNLGKNGAILFFWP
KDFTFVCPTEIIAFDKRVKDFQEKGFNVIGVSIDSEQVHFAWK
NTPVEKGGIGQVTFPMVADITKSISRDYDVLFEEAIALRGAFLI
DKNMKVRHAVINDLPLGRNADEMLRMVDALLHFEEHGEVCP
AGWRKGDKGMKATHQGVAEYLKENSIKL.

Usage

ProSpec's products are furnished for LABORATORY RESEARCH USE ONLY. The product may not be used as drugs, agricultural or pesticidal products, food additives or household chemicals.
Back to Top