prospec

MIF Human His N

  • Name
  • Description
  • Pricings
  • Quantity
  • MIF Human His N
  • Macrophage Migration Inhibitory Factor Human, Recombinant His Tag N-Terminus
  • Shipped with Ice Packs

Catalogue number

CYT-431

Synonyms

Phenylpyruvate tautomerase, Glycosylation-inhibiting factor, GIF, MMIF, MIF.

Introduction

The cytokine Macrophage migration inhibitory factor (MIF) has been identified to be secreted by the pituitary gland and the monocyte/macrophage and to play an important role in endotoxic shock. MIF has the unique property of being released from macrophages and T cells in response to physiological concentrations of glucocorticoids. The secretion of MIF is tightly regulated and decreases at high, anti-inflammatory steroid concentration.

Description

MIF human Recombinant, fused to His-tag at N-terminus, was cloned into an E. coli expression vector and was purified to apparent homogeneity by using conventional column chromatography techniques.
Macrophage Inducing Factor Human Recombinant is a single, non-glycosylated, polypeptide chain having amino acids from 1-114 and having a molecular mass of 16.6 kDa.

Source

Escherichia Coli.

Physical Appearance

Sterile filtered colorless solution.

Formulation

1mg/ml solution containing PBS pH-7.4.

Stability

Liquid MIF although stable 4°C for 1 week, should be stored below -18°C.
Please prevent freeze-thaw cycles.

Purity

Greater than 95.0% as determined by:
(a) Analysis by RP-HPLC.
(b) Analysis by SDS-PAGE.

Amino acid sequence

MRGSHHHHHHGMASMTGGQQMGRDLYDDDDKDRWGSMPMFIVNTNV PRASVPDGFL SELTQQLAQA TGKPPQYIAV HVVPDQLMAF GGSSEPCALC LHSIGKIGGA QNRSYSKLLC GLLAERLRIS PDRVYINYYD MNAANVGWNN STFA.

Usage

ProSpec's products are furnished for LABORATORY RESEARCH USE ONLY. The product may not be used as drugs, agricultural or pesticidal products, food additives or household chemicals.
Back to Top