prospec

HPV 16

  • Name
  • Description
  • Pricings
  • Quantity
  • HPV 16
  • Human Papillomavirus 16 Recombinant
  • Shipped with Ice Packs

Catalogue number

HPV-001

Synonyms

Papillomavirus, HPV, Papilloma Virus.

Introduction

Human papillomavirus family consist of over 200 types. Over than 30 to 40 types of HPV are transferred via sexual contact and infect the anogenital region initiating genital warts. Persistent infection with "high-risk" HPV types results in skin warts and leads to precancerous lesions and invasive cancer. HPV infection is considered as a source for all incidents of cervical cancer.

Description

The Recombinant HPV-16 antigen is a full length protein expressed in E. coli having an Mw of 56.7kDa. The protein is fused to a 26kDa GST-Tag, having a total Mw of 82.7kDA and purified by standard chromatography.

Source

E.Coli.

Purification Method

The recombinant HPV-16 fusion protein was purified by GSH affinity chromatography technique.

Physical Appearance

Sterile filtered clear liquid formulation.

Formulation

Recombinant HPV-16 solution in PBS, 100mM arginine and 3M Urea.

Stability

Recombinant HPV-16 although stable at 4°C for 1 week, should be stored below -18°C.
Please prevent freeze thaw cycles.

Purity

Protein is >90% pure as determined by 10% SDS-PAGE (Coomassie staining).

Amino acid sequence

MQVTFIYILVITCYENDVNVYHIFFQMSLWLPSEATVYLPPVPVSKVVSTDEYVARTN
IYYHAGTSRLLAVGHPYFPIKKPNNNKILVPKVSGLQYRVFRIHLPDPNKFGFPDTSF
YNPDTQRLVWACVGVEVGRGQPLGVGISGHPLLNKLDDTENASAYAANAGVDNRECIS
MDYKQTQLCLIGCKPPIGEHWGKGSPCTNVAVNPGDCPPLELINTVIQDGDMVHTGFG
AMDFTTLQANKSEVPLDICTSICKYPDYIKMVSEPYGDSLFFYLRREQMFVRHLFNRA
GTVGENVPDDLYIKGSGSTANLASSNYFPTPSGSMVTSDAQIFNKPYWLQRAQGHNNG
ICWGNQLFVTVVDTTRSTNMSLCAAISTSETTYKNTNFKEYLRHGEEYDLQFIFQLCK
ITLTADVMTYIHSMNSTILEDWNFGLQPPPGGTLEDTYRFVTQAIACQKHTPPAPKED
DPLKKYTFWEVNLKEKFSADLDQFPLGRKFLLQAGLKAKPKFTLGKRKATPTTSSTST
TAKRKKRKL.

Usage

ProSpec's products are furnished for LABORATORY RESEARCH USE ONLY. They may not be used as drugs, agricultural or pesticidal products, food additives or household chemicals.
Back to Top