prospec

HIV-1 Integrase

  • Name
  • Description
  • Pricings
  • Quantity
  • HIV-1 Integrase
  • HIV-1 Integrase Recombinant
  • Shipped with Ice Packs

Catalogue number

HIV-122

Introduction

Integrase is an enzyme produced by the HIV which enables its genetic material to be integrated into the DNA of the infected cell and is a key component in the pre-integration complex. HIV integrase contains 3 domains, an N-terminal HH-CC zinc fingerdomainwhich is partially responsible for multimerization, a central catalytic domain and a C-terminal domain. Both Central catalytic domain and C-terminal domains have been shown to bind both viral and cellular DNA. No crystal structure data exists with Integrase bound to its DNA substrates. HIV-1 integrase functions as a dimeror a tetramer. Additionally, several host cellular proteins interact with integrase and may facilitate the integration process.

Description

The E.coli derived 36 kDa recombinant protein is a non-glycosylated polypeptide chain, containing the HIV-1 immunodominant regions from the pol protein (intergrase) and fused with a six histidines tag.

Source

Escherichia Coli.

Physical Appearance

Sterile filtered colorless clear solution.

Formulation

1.5M urea, 25mM Tris-HCl pH 8.0, 0.2% Triton-X & 50% Glycerol.

Purity

Greater than 95.0% as determined by SDS-PAGE.

Stability

HIV-1 Integrase although stable at 4°C for 1 week, should be stored below -18°C.
Please prevent freeze thaw cycles.

Specificity

Immunoreactive with all sera of HIV-1 infected individuals.

Applications

HIV-1 Integrase antigen is suitable for ELISA and Western blots, excellent antigen for early detection of HIV seroconvertors with minimal specificity problems.

Amino acid sequence

mfldgidkaqeehekyhsnwramasdfnlppvvakeivascdkcqlkgea
mhgqvdcspgiwqldcthlegkvilvavhvasgyieaevipaetgqetayfilk
lagrwpvktihtdngsnftsttvkaacwwagikqefgipynpqsqgviesmn
kelkkiigqvrdqaehlktavqmavfihnfkrkggiggysagerivdiiatdiqtk
elqkqitkiqnfrvyyrdsrdplwkgpakllwkgegavviqdnsdikvvprrka
kiirdygkqmagddcvasrqdedhhhhhh.

Usage

ProSpec's products are furnished for LABORATORY RESEARCH USE ONLY. The product may not be used as drugs, agricultural or pesticidal products, food additives or household chemicals.
Back to Top