prospec

HGH Antibody

  • Name
  • Description
  • Pricings
  • Quantity
  • HGH Antibody
  • Growth Hormone Polyclonal Rabbit Anti Human Antibody
  • Shipped with Ice Packs

Catalogue number

ANT-036

Synonyms

GH1, GH, GHN, GH-N, hGH-N,Pituitary growth hormone, Growth hormone 1, Somatotropin.

Type

Polyclonal Rabbit Antibody.

Introduction

GH is a member of the somatotropin/prolactin family of hormones which play an important role in growth control. The gene, along with four other related genes, is located at the growth hormone locus on chromosome 17 where they are interspersed in the same transcriptional orientation; an arrangement which is thought to have evolved by a series of gene duplications. The five genes share a remarkably high degree of sequence identity. Alternative splicing generates additional isoforms of each of the five growth hormones, leading to further diversity and potential for specialization. This particular family member is expressed in the pituitary but not in placental tissue as is the case for the other four genes in the growth hormone locus. Mutations in or deletions of the gene lead to growth hormone deficiency and short stature.

Purity

Greater than 98%.

Immunogen

IgG Anti HGH has been developed in rabbit using highly pure (>98%) recombinant human HGH expressed in plants.

Antigen Amino Acid Sequence

FPTI PLSRLFDNAM LRAHRLHQLAFDTYQ EFEEAYIPKEQKYSFLQNPQTSLCFSESIPTPSNRE ETQQKSNLE LLRISLLLIQSWLEPVQFLRSVFANSLVYGASDSNVYDLL KDLEEGIQTLMGRLE DGSPRTGQIFKQ TYSK DTNSHNDDALLKNYGLLYCFRK DM DKVETFLRIVQCRSVEGSCGF

Purification Method

Purified IgG prepared by affinity chromatography on protein G.

Formulation

Lyophilized from a sterile filtered (0.2µm) solution containing phosphate buffered saline.

Solubility

Add distilled water at 1:2 ratio and let the lyophilized pellet dissolve completely.

Stability

Store at -20°C. For long term storage freezes in working aliquots at -20°C. 
Repeated freezing and thawing is not recommended.

Applications

ELISA: to detect HGH by indirect ELISA, a dilution of at least 1/1,000 of this antibody is required. This antibody, in conjunction with compatible secondary reagents (anti rabbit AP conjugated), allows the detection of 0.2-1 ng/well of HGH.
Western Blot: to detect HGH by WB analysis this antibody can be used in a dilution of 1/1,500.

Usage

ProSpec's products are furnished for LABORATORY RESEARCH USE ONLY. The product may not be used as drugs, agricultural or pesticidal products, food additives or household chemicals.
Back to Top