prospec

CDH1 Human, HEK

  • Name
  • Description
  • Pricings
  • Quantity
  • CDH1 Human, HEK
  • E-Cadherin Human Recombinant, HEK
  • Shipped at Room temp.

Catalogue number

PRO-2197

Synonyms

Epithelial cadherin, E-cadherin, Uvomorulin, Cadherin-1, CAM 120/80, CD324 antigen, CDH1, CDHE, UVO, ECAD, LCAM, Arc-1, CD324, Cadherin-E.

Introduction

E-cadherin (uvomorulin, cell-CAM120/80) is a calcium dependent cell adhesion molecule expressed predominately in epithelial tissues. It plays an important role in the growth and development of cells via the mechanisms of control of tissue architecture and the maintenance of tissue integrity. Numerous studies have demonstrated that reduction and/or loss of Ecadherin expression in carcinomas correlates positively with the potential of these tumors for invasion and metastasis.

Description

E-Cadherin Human Recombinant produced in HEK cells is a secreted protein with the sequence of Human E-Cadherin (amino acids Asp155-Ile707) and fused to a 6xHis tag at the C-terminus.

Source

HEK cells.

Physical Appearance

Sterile Filtered White lyophilized (freeze-dried) powder.

Formulation

The CDH1 protein was lyophilized from a 0.2µm filtered solution in PBS, pH7.4.

Solubility

It is recommended to reconstitute the lyophilized CDH1 in sterile 18M-cm H2O not less than 100µg/ml, which can then be further diluted to other aqueous solutions.

Stability

Lyophilized E-Cadherin although stable at room temperature for 3 weeks, should be stored desiccated below -18°C. Upon reconstitution CDH1 should be stored at 4°C between 2-7 days and for future use below -18°C.
For long term storage it is recommended to add a carrier protein (0.1% HSA or BSA).
Please prevent freeze-thaw cycles.

Purity

Greater than 95.0% as determined by SDS-PAGE.

Amino acid sequence

DWVIPPISCPENEKGPFPKNLVQIKSNKDKEGKVFYSITGQGADTPPVGVFIIERETGWL
KVTEPLDRERIATYTLFSHAVSSNGNAVEDPMEILITVTDQNDNKPEFTQEVFKGSVME
GALPGTSVMEVTATDADDDVNTYNAAIAYTILSQDPELPDKNMFTINRNTGVISVVTTG
LDRESFPTYTLVVQAADLQGEGLSTTATAVITVTDTNDNPPIFNPTTYKGQVPENEANVV
ITTLKVTDADAPNTPAWEAVYTILNDDGGQFVVTTNPVNNDGILKTAKGLDFEAKQQYIL
HVAVTNVVPFEVSLTTSTATVTVDVLDVNEAPIFVPPEKRVEVSEDFGVGQEITSYTAQEP
DTFMEQKITYRIWRDTANWLEINPDTGAISTRAELDREDFEHVKNSTYTALIIATDNGSPV
ATGTGTLLLILSDVNDNAPIPEPRTIFFCERNPKPQVINIIDADLPPNTSPFTAELTHGASAN
WTIQYNDPTQESIILKPKMALEVGDYKINLKLMDNQNKDQVTTLEVSVCDCEGAAGVCR
KAQPVEAGLQIHHHHHH.

Usage

ProSpec's products are furnished for LABORATORY RESEARCH USE ONLY. The product may not be used as drugs, agricultural or pesticidal products, food additives or household chemicals.
Back to Top