prospec

VCAM1 Human, HEK

  • Name
  • Description
  • Pricings
  • Quantity
  • VCAM1 Human, HEK
  • Vascular cell adhesion molecule 1 Human Recombinant, HEK
  • Shipped at Room temp.

Catalogue number

PRO-1641

Synonyms

Vascular cell adhesion protein 1, V-CAM 1, INCAM-100, CD106, VCAM1, L1CAM, MGC99561, DKFZp779G2333.

Introduction

VCAM1 is a member of the Ig superfamily. It is a cell surface sialoglycoprotein expressed by cytokine activated endothelium. VCAM-1 contains 6 or 7 immunoglobulin domains, and is expressed on both large and small vessels only after the endothelial cells are stimulated by cytokines. The protein has a number of functions including the regulation of leukocyte migration, leukocyte endothelial cell adhesion and signal transduction and may play a role in a number of inflammatory diseases (artherosclerosis and rheumatoid arthritis).

Description

VCAM1 Human Recombinant produced by mammalian expression system in human cells is a single polypeptide chain containing 682 amino acids (25-698). VCAM1 is fused to an 8 amino acid His-tag at C-terminus & purified by proprietary chromatographic techniques.

Source

HEK293 cells.

Physical Appearance

Sterile Filtered White lyophilized (freeze-dried) powder.

Formulation

VCAM1 was lyophilized from a 0.2 µM filtered solution of 20mM PB, 150mM NaCl, 2mM CaCl2, 2mM MgCl2 and 5%Threhalose, pH 7.2.

Solubility

It is recommended to reconstitute the lyophilized VCAM1 in 1xPBS to a concentration no less than 100 µg/ml, which can then be further diluted to other aqueous solutions.

Stability

Lyophilized VCAM1 although stable at room temperature for 3 weeks, should be stored desiccated below -18°C. Upon reconstitution VCAM1 should be stored at 4°C between 2-7 days and for future use below -18°C.
Please prevent freeze-thaw cycles.

Purity

Greater than 95% as determined by SDS-PAGE.

Amino acid sequence

FKIETTPESRYLAQIGDSVSLTCSTTGCESPFFSWRTQIDSPLNGKVTNEGTTS
TLTMNPVSFGNEHSYLCTATCESRKLEKGIQVEIYSFPKDPEIHLSGPLEAGKP
ITVKCSVADVYPFDRLEIDLLKGDHLMKSQEFLEDADRKSLETKSLEVTFTPVIE
DIGKVLVCRAKLHIDEMDSVPTVRQAVKELQVYISPKNTVISVNPSTKLQEGGSVT
MTCSSEGLPAPEIFWSKKLDNGNLQHLSGNATLTLIAMRMEDSGIYVCEGVNLIGKNRKEV
ELIVQEKPFTVEISPGPRIAAQIGDSVMLTCSVMGCESPSFSWRTQIDSPLSGKVRSEGTN
STLTLSPVSFENEHSYLCTVTCGHKKLEKGIQVELYSFPRDPEIEMSGGLVNGSSVTVSCKV
PSVYPLDRLEIELLKGETILENIEFLEDTDMKSLENKSLEMTFIPTIEDTGKALVCQAKLHID
DMEFEPKQRQSTQTLYVNVAPRDTTVLVSPSSILEEGSSVNMTCLSQGFPAPKILWSRQLPNGE
LQPLSENATLTLISTKMEDSGVYLCEGINQIRKAQLKDAGVYECESKNKVGSQLRSLTLDVQGRE
NNKDYFSPEVDHHHHHHAGRSRKEVELIIQVTPKDIKLTAFPSESVKEGDTVIISCTCGNVPETW
IILKKKAETGDTVLKSIDGAYTIRKAQLKDAGVYECESKNKVGSQLRSLTLDVQGRENNKDYFSPE
VDHHHHHH.

Safety Data Sheet

Usage

ProSpec's products are furnished for LABORATORY RESEARCH USE ONLY. The product may not be used as drugs, agricultural or pesticidal products, food additives or household chemicals.
Back to Top