prospec

PON2 Human

  • Name
  • Description
  • Pricings
  • Quantity
  • PON2 Human
  • Paraoxonase-2 Human Recombinant
  • Shipped with Ice Packs

Catalogue number

ENZ-300

Synonyms

Serum paraoxonase, arylesterase 2, EC 3.1.1.2, EC 3.1.8.1, PON 2, Serum aryldialkylphosphatase 2, A-esterase 2, Aromatic esterase 2.

Introduction

Paraoxonase 2 (PON2) is a member of a multigene family whose genes share 65% identity at the amino acid level, and is expressed in a variety of tissues, including the pancreas. PON2 overexpression has been shown to lower the intracellular oxidative state and reduce the cells ability to oxidize LDL. PON2 is therefore implicated in the modulation of oxidative stress.

Description

Paraoxonase-2 Human Recombinant is expressed in E. coli having a molecular weight of 43.5 kDa and fused to an amino terminal hexahistidine tag.
The PON2 purified by proprietary chromatographic techniques.

Source

Escherichia Coli.

Physical Appearance

Sterile Filtered clear solution.

Formulation

PON2 is supplied in PBS and 50% glycerol.

Applications

Arylesterase 2 can be used directly as a positive control in Western blotting, ELISA, immunoprecipitation and other immunological experiments. 
The biological activity of this product has not yet been tested.

Amino acid sequence

MGRLVAVGLLGIALALLGERLLALRNRLKASREVESVDLPHCHLIKGIEAGSEDID ILPNGLAFFSVGLKFPGLHSFAPDKPGGILMMDLKEEKPRARELRISRGFDLASFNP HGISTFIDNDDTVYLFVVNHPEFKNTVEIFKFEEAENSLLHLKTVKHELLPSVNDIT AVGPAHFYATNDHYFSDPFLKYLETYLNLHWANVVYYSPNEVKVVAEGFDSAN GINISPDDKYIYVADILAHEIHVLEKHTNMNLTQLKVLELDTLVDNLSIDPSSGDIW VGCHPNGQKLFVYDPNNPPSSEVLRIQNILSEKPTVTTVYANNGSVLQGSSVASVY DGKLLIGTLYHRALYCELZ.

Stability

Store at 4°C if entire vial will be used within 1-2 weeks. 
Store, frozen at -20°C for longer periods of time. 
Avoid multiple freeze-thaw cycles.

Purity

Greater than 95% as determined by SDS-PAGE.
Single band on Western Blot.

Safety Data Sheet

Usage

Prospec's products are furnished for LABORATORY RESEARCH USE ONLY. The product may not be used as drugs, agricultural or pesticidal products, food additives or household chemicals.
Back to Top