prospec

PON1 Human

  • Name
  • Description
  • Pricings
  • Quantity
  • PON1 Human
  • Paraoxonase-1 Human Recombinant
  • Shipped with Ice Packs

Catalogue number

ENZ-299

Synonyms

Serum paraoxonase, arylesterase 1, EC 3.1.1.2, EC 3.1.8.1, PON 1, Serum aryldialkylphosphatase 1, A-esterase 1, Aromatic esterase 1, K-45, ESA, PON.

Introduction

Paraoxonase 1 also called Esterase-A is involved in the detoxification of organophosphate insecticides such as parathion. Paraoxonase 1 may also confer protection against coronary artery disease by destroying proinflammatory oxidized lipids present in oxidized low-density lipoproteins (LDLs).

Description

Paraoxonase-1 Isoform Human Recombinant is expressed in E. coli, fused to a 4.5kDa amino terminal hexahistidine tag, having a total molecular weight of 42.9kDa.

The PON1 purified by proprietary chromatographic techniques.

Source

Escherichia Coli.

Physical Appearance

Sterile Filtered clear solution.

Formulation

PON1 is supplied in 20mM Tris-HCl pH 8.0 and 50% glycerol.

Stability

Store at 4°C if entire vial will be used within 1-2 weeks. 
Store, frozen at -20°C for longer periods of time. 
Avoid multiple freeze-thaw cycles.

Amino acid sequence

MAKLIALTLLGMGLALFRNHQSSYQTRLNALREVQPVELPNCNLVKGIE
TGSEDLEILPNGLAFISSGLKYPGIKSFNPNSPGKILLMDLNEEDPTVLE
LGITGSKFDVSSFNPHGISTFTDEDNAMYLLVVNHPDAKSTVELFKFQE
EEKSLLHLKTIRHKLLPNLNDIVAVGPEHFYGTNDHYFLDPYLRSWEM
YLGLAWSYVVYYSPSEVRVVAEGFDFANGINISPDGKYVYIAELLAHKIHV
YEKHANWTLTPLKSLDFNTLVDNISVDPETGDLWVGCHPNGMKIFFYD
SENPPASEVLRIQNILTEEPKVTQVYAENGTVLQGSTVASVYKGKLLIGT
VFHKALYCELZ.

Purity

Greater than 95% as determined by SDS-PAGE.
Single band on Western Blot.

Safety Data Sheet

Usage

Prospec's products are furnished for LABORATORY RESEARCH USE ONLY. The product may not be used as drugs, agricultural or pesticidal products, food additives or household chemicals.
Back to Top