prospec

IFN a 2a Antibody

  • Name
  • Description
  • Pricings
  • Quantity
  • IFN a 2a Antibody
  • Interferon a 2a Polyclonal Rabbit Anti-Human Antibody
  • Shipped with Ice Packs

Catalogue number

ANT-034

Synonyms

Leukocyte interferon, B cell interferon, Type I interferon, IFNA2, IFN-a 2a.

Type

Polyclonal Rabbit Antibody.

Introduction

IFN-alpha is produced by macrophages and has antiviral activities. Interferon stimulates the production of two enzymes: protein kinase and an oligoadenylate synthetase.

Purity

Greater than 98.0% as determined by Analysis by SDS-PAGE.

Immunogen

IgG Anti Human Interferon a 2a is developed in rabbit using recombinant Human Interferon a 2a expressed in plants.

Antigen Amino Acid Sequence

CDLPQTHSLGSRRTLMLLAQMRKISLFSCLKDRHDFGFPQEEFGNQFQKAETIPVLHEMIQQ
IFNLFSTKDSSAAWDETLLDKFYTELYQQLNDLEACVIQGVGVTETPLMNEDSILAVRKYFQR
ITLYLKEKKYSPCAWEVVRAEIMRSFSLSTNLQESLRSKE

Purification Method

Purified IgG prepared by affinity chromatography on protein G.

Formulation

Lyophilized from 0.2μm sterile filtered solution in phosphate buffered saline, pH 7.4.

Solubility

Reconstitute with H20.  Mix gently, wash the sides of the vial and wait 30-60 seconds before use.  

Stability

Store at -20°C. For long term storage freezes in working aliquots at -20°C. 
Repeated freezing and thawing is not recommended.

Applications

ELISA: to detect Human Interferon a 2a by indirect ELISA a dilution of at least 1/500 of this antibody is required. This antibody, in conjunction with compatible secondary reagents (anti rabbit AP conjugated), allows the detection of 0.2-1 ng /well of human Interferon a 2a.

Western Blot: to detect human Interferon a2a by WB analysis this antibody can be used in a dilution of 1/1,000. 

Usage

ProSpec's products are furnished for LABORATORY RESEARCH USE ONLY. The product may not be used as drugs, agricultural or pesticidal products, food additives or household chemicals.
Back to Top