prospec

IFN a 2a Antibody

  • Name
  • Description
  • Pricings
  • Quantity
  • IFN a 2a Antibody
  • Interferon a 2a Polyclonal Rabbit Anti-Human Antibody
  • Shipped with Ice Packs

Catalogue number

ANT-034

Synonyms

Leukocyte interferon, B cell interferon, Type I interferon, IFNA2, IFN-a 2a.

Type

Polyclonal Rabbit Antibody.

Introduction

IFN-alpha is produced by macrophages and has antiviral activities. Interferon stimulates the production of two enzymes: protein kinase and an oligoadenylate synthetase.

Purity

Greater than 98%.

Immunogen

IgG Anti Human Interferon a 2a is developed in rabbit using recombinant Human Interferon a 2a expressed in plants.

Antigen Amino Acid Sequence

CDLPQTHSLGSRRTLMLLAQMRKISLFSCLKDRHDFGFPQEEFGNQFQKAETIPVLHEMIQQ
IFNLFSTKDSSAAWDETLLDKFYTELYQQLNDLEACVIQGVGVTETPLMNEDSILAVRKYFQR
ITLYLKEKKYSPCAWEVVRAEIMRSFSLSTNLQESLRSKE

Purification Method

Purified IgG prepared by affinity chromatography on protein G.

Formulation

Lyophilized from a sterile filtered (0.2µm) solution containing phosphate buffered saline.

Solubility

Add distilled water at 1:2 ratio and let the lyophilized pellet dissolve completely.

Stability

Store at -20°C. For long term storage freezes in working aliquots at -20°C. 
Repeated freezing and thawing is not recommended.

Applications

ELISA: to detect Human Interferon a 2a by indirect ELISA a dilution of at least 1/1,000 of this antibody is required. This antibody, in conjunction with compatible secondary reagents (anti rabbit AP conjugated), allows the detection of 0.2-1 ng /well of human Interferon a 2a.
Western Blot: to detect human Interferon a2a by WB analysis this antibody can be used in a dilution of 1/1,500.

Usage

ProSpec's products are furnished for LABORATORY RESEARCH USE ONLY. The product may not be used as drugs, agricultural or pesticidal products, food additives or household chemicals.
Back to Top