prospec

HSV-2 gB

  • Name
  • Description
  • Pricings
  • Quantity
  • HSV-2 gB
  • Herpes Simplex Virus-2 gB Recombinant
  • Shipped with Ice Packs

Catalogue number

HSV-226

Introduction

Entry of HSV into the host cell involves interactions of several viral glycoproteins with cell surface receptors. The virus particle is covered by an envelope which, when bound to specific receptors on the cell surface, will fuse with the cell membrane and create an opening, or pore, through which the virus enters the host cell. The sequential stages of HSV entry are analagous to those of other viruses. At first, complementary receptors on the virus and cell surface bring the two membranes into proximity. In an intermediate state, the two membranes begin to merge, forming a hemifusion state. Finally, a stable entry pore is formed through which the viral envelope contents are introduced to the host cell.

Description

The E.Coli derived HSV-2 gB recombinant protein is fused to a Six histidine tag at C-terminus and has a MW of 82kDa (pI 8.35).

Source

Escherichia Coli.

Purity

Protein is >90% pure as determined by SDS PAGE.

Physical Appearance

Sterile Filtered clear solution.

Formulation

10mM Phosphate buffer pH 7.6 and 75mM NaCl.

Stability

HSV-2 gB although stable at 4°C for 1 week, should be stored below -18°C. 
Please prevent freeze thaw cycles.

Amino acid sequence

MIAPYKFKATMYYKDVTVSQVWFGHRYSQFMGIFEDRAPVPFEEVIDKINAKGVCRST AKYVRNNLETTAFHRDDHETDMELKPANAATRTSRGWHTTDLKYNPSRVEAFHRYGT
TVNCIVEEVDARSVYPYDEFVLATGDFVYMSPFYGYREGSHTEHTSYAADRFKQVDGF
YARDLTTKARATAPTTRNLLTTPKFTVAWDWVPKRPSVCTHHHHHH.

Applications

ELISA, WB, Flow-Through.

Safety Data Sheet

Usage

ProSpec's products are furnished for LABORATORY RESEARCH USE ONLY. The product may not be used as drugs, agricultural or pesticidal products, food additives or household chemicals.
Back to Top