prospec

TGFB1 Human, GST

  • Name
  • Description
  • Pricings
  • Quantity
  • TGFB1 Human, GST
  • Transforming Growth Factor-Beta 1 Human Recombinant, GST Tag
  • Shipped with Ice Packs

Catalogue number

CYT-473

Synonyms

Transforming growth factor beta-1, TGF-beta-1, CED, DPD1, TGFB.

Introduction

Transforming growth factor betas (TGF Betas) mediate many cell-cell interactions that occur during embryonic development. Three TGF Betas have been identified in mammals. TGF Beta 1, TGF Beta 2 and TGF Beta 3 are each synthesized as precursor proteins that are very similar in that each is cleaved to yield a 112 amino acid polypeptide that remains associated with the latent portion of the molecule.

Description

The Recombinant Human TGF-b1 (aa 309-390) is purified by standard chromatographic techniques and shows a 35kDa band on SDS-PAGE (including GST tag).

Source

Escherichia Coli.

Physical Appearance

Sterile Filtered solution.

Formulation

The protein solution (500µg/ml) contains 50mM Tris-HCl, pH-7.5 and 10mM L-glutathione (reduced).

Stability

Store at 4°C if entire vial will be used within 2-4 weeks. Store, frozen at -20°C for longer periods of time.
For long term storage it is recommended to add a carrier protein (0.1% HSA or BSA).
Avoid multiple freeze-thaw cycles.

Purity

Greater than 80.0% as determined by SDS-PAGE.

Amino acid sequence

KWIHEPKGYHANFCLGPCPYIWSLDTQYSKVLALYNQHNPGASAAPCCVPQALEPLPIVYYVGRK
PKVEQLSNMIVRSCKCS.

Usage

Prospec's products are furnished for LABORATORY RESEARCH USE ONLY. They may not be used as drugs, agricultural or pesticidal products, food additives or household chemicals.
Back to Top