prospec

IL 6 Human, CHO

  • Name
  • Description
  • Pricings
  • Quantity
  • IL 6 Human, CHO
  • Interleukin-6 Recombinant Human, CHO
  • Shipped with Ice Packs

Catalogue number

CYT-274

Synonyms

IFN-b2, B cell differentiation factor, BCDF, BSF-2, HPGF, HSF, MGI-2, B-cell stimulatory factor 2, Interferon beta-2, Hybridoma growth factor, CTL differentiation factor, CDF, IL-6, HGF.

Introduction

IL-6 is a cytokine with a wide variety of biological functions: it plays an essential role in the final differentiation of b-cells into ig-secreting cells, it induces myeloma and plasmacytoma growth, it induces nerve cells differentiation, in hepatocytes it induces acute phase reactants.

Description

Interleukin-6 Human Recombinant produced in CHO is a 21-23kDa single, glycosylated polypeptide chain containing 183 amino acids.

Source

Chinese Hamster Ovarian Cells.

Physical Appearance

Sterile filtered colorless solution.

Formulation

IL-6 is a sterile filtered (0.22µm) solution (0.22mg/ml) in 20mM Tris-HCl buffer pH 7.2.

Stability

Store at 4°C if entire vial will be used within 2-4 weeks. Store, frozen at -20°C for longer periods of time.
For long term storage it is recommended to add a carrier protein (0.1% HSA or BSA).
Avoid multiple freeze-thaw cycles.

Purity

Greater than 95.0% as determined by analysis by SDS-PAGE.

Amino acid sequence

VPPGEDSKDVAAPHRQPLTSSERIDKQIRYILDGISALRKETCNKSNMCESSKEALAENN
LNLPKMAEKDGCFQSGFNEETCLVKIITGLLEFEVYLEYLQNRFESSEEQARAVQMSTKV
LIQFLQKKAKNLDAITTPDPTTNASLLTKLQAQNQWLQDMTTHLILRSFKEFLQSSLRAL
RQM

Biological Activity

ED50 < 1 ng/ml. The activity was determined by the dose dependent stimulation of the proliferation of human TF-1 cells (human erythroleukemic indicator cell line).

Usage

ProSpec's products are furnished for LABORATORY RESEARCH USE ONLY. They may not be used as drugs, agricultural or pesticidal products, food additives or household chemicals.
Back to Top