prospec

HGF A Human

  • Name
  • Description
  • Pricings
  • Quantity
  • HGF A Human
  • Hepatocyte Growth Factor A Chain Human Recombinant
  • Shipped with Ice Packs

Catalogue number

CYT-664

Synonyms

Scatter Factor, SF, Hepatopoietin, HPTA, HGF, HGFB, F-TCF, DFNB39, Hepatocyte growth factor, Hepatopoeitin-A, Hepatocyte growth factor alpha chain.

Introduction

Hepatocyte Growth Factor (HGF) is a multifunctional growth factor which regulates both cell growth and cell motility. It exerts a strong mitogenic effect on hepatocytes and primary epithelial cells. HGF synergizes with Interleukin-3 and GM-CSF to stimulate colony formation of hematopoietic progenitor cells in vitro and may, therefore, also modulate hematopoiesis. HGF is secreted as a single inactive polypeptide which is cleaved by serine proteases into a 69kDa Alpha chain and 34kDa Beta chain. A disulfide bond linking the alpha and beta chains produces the active, heterodimeric molecule.

Description

HGF-A Human Recombinant produced in E.Coli is a single, non-glycosylated, Polypeptide chain containing 463 amino acids fragment (32-494) having a total molecular weight of 57.8kDa. The HGF-A is fused with a 4.5kDa amino-terminal hexahistidine tag.
The HGF-A is purified by proprietary chromatographic techniques.

Source

Escherichia Coli.

Physical Appearance

Sterile Filtered clear solution.

Formulation

HGF-A protein is supplied in 25mM Na. Acetate pH4.8, 1mM EDTA and 50% glycerol.

Stability

Store at 4°C if entire vial will be used within 2-4 weeks.
Store, frozen at -20°C for longer periods of time.
Please avoid freeze thaw cycles.

Purity

Greater than 95.0% as determined by SDS-PAGE.

Amino acid sequence

QRKRRNTIHEFKKSAKTTLIKIDPALKIKTKKVNTADQCAN
RCTRNKGLPFTCKAFVFDKARKQCLWFPFNSMSSGVKK
EFGHEFDLYENKDYIRNCIIGKGRSYKGTVSITKSGIKCQP
WSSMIPHEHSFLPSSYRGKDLQENYCRNPRGEEGGPWC
FTSNPEVRYEVCDIPQCSEVECMTCNGESYRGLMDHTES
GKICQRWDHQTPHRHKFLPERYPDKGFDDNYCRNPDGQ
PRPWCYTLDPHTRWEYCAIKTCADNTMNDTDVPLETTEC
IQGQGEGYRGTVNTIWNGIPCQRWDSQYPHEHDMTPEN
FKCKDLRENYCRNPDGSESPWCFTTDPNIRVGYCSQIPNC
DMSHGQDCYRGNGKNYMGNLSQTRSGLTCSMWDKNME
DLHRHIFWEPDASKLNENYCRNPDDDAHGPWCYTGNPLIP
WDYCPISRCEGDTTPTIVNLDHPVISCAKTKQLR.

Usage

ProSpec's products are furnished for LABORATORY RESEARCH USE ONLY. The product may not be used as drugs, agricultural or pesticidal products, food additives or household chemicals.
Back to Top