NEDD8-conjugating enzyme Ubc12, EC 6.3.2.-, Ubiquitin-conjugating enzyme E2 M, NEDD8 protein ligase, NEDD8 carrier protein, UBC12, hUbc12, UBC-RS2.
UbcH12 is functional in in vitro NEDDylation reactions. It has been shown to form a thioester linkage with NEDD8 in the presence of the NEDD8 activating enzyme complex Uba3/APP-BP1. APP-BP1 binds to the amyloid precursor protein (APP) carboxy terminal domain and is important in conjunction with Uba3 and UbcH12 in driving cells through the S to M checkpoint. It was demonstrated to be the E2 responsible for the NEDDylation of the Cul-1 component of the SCF (β-TRCP) complex which is important as the E3-ligase in the ubiquitinylation of IκBα. NEDDylation of Cul-1 is essential for conjugation and processing of NF-κB p105 by SCF (β-TRCP) following phosphorylation of the complex. A dominant negative form of UbcH12, previously demonstrated to sequester NEDD8 and inhibit its conjugation, inhibits both conjugation and processing of p105, which is alleviated by wild-type UbcH12.
Ubiquitin Conjugating Enzyme 12 Human Recombinant produced in E.coli is a 25 kDa protein containing 216 amino acids.
The Ubc12 protein contains 6xHis tag and is purified by proprietary chromatographic techniques.
Escherichia Coli.
Sterile Filtered whilte lyophilized powder.
Lyophilized from a 0.2μm filtered concentrated (1 mg/ml) solution in 1X PBS and 1mM DTT, pH 7.5.
It is recommended to reconstitute the lyophilized Ubc12 in sterile water not less than 100µg/ml, which can then be further diluted to other aqueous solutions.
Lyophilized Ubc12 although stable at room temperature for 3 weeks, should be stored desiccated below -18°C. Upon reconstitution Ubc12 should be stored at 4°C between 2-7 days and for future use below -18°C.
For long term storage it is recommended to add a carrier protein (0.1% HSA or BSA).
Please prevent freeze-thaw cycles.
Greater than 95.0% as determined by:
(a) Analysis by RP-HPLC.
(b) Analysis by SDS-PAGE.
MSYYHHHHHHDYDIPTTENLYFQGAMDPEFRIWMIKLFSLKQQKKEEESAGGTK
GSSKKASAAQLRIQKDINELNLPKTCDISFSDPDDLLNFKLVICPDEGFYKSGKFVF
SFKVGQGYPHDPPKVKCETMVYHPNIDLEGNVCLNILREDWKPVLTINSIIYGLQ
YLFLEPNPEDPLNKEAVLQNNRRLFEQNVQRSMRGGYIGSTYFERCLK.
Prospec's products are furnished for LABORATORY RESEARCH USE ONLY.They may not be used as drugs,agricultural or pesticidal products, food additives or household chemicals.