|
|
|
|
|
|
|
|
|
|
|
|
|
Catalogue Number
|
ENZ-343
|
|
Synonyms
|
Ubiquitin-conjugating enzyme E2 D3, EC 6.3.2.19, Ubiquitin-protein ligase D3, Ubiquitin carrier protein D3, Ubiquitin-conjugating enzyme E2-17 kDa 3, E2(17)KB 3, UBC4/5, UBCH5C, MGC5416, MGC43926, UBE2D3.
|
|
Introduction
|
UBE2D3 enzymes are human homologs of the yeast UBC4/5 family and play many important regulatory roles in inflammation and cancer. UbcH5a mediates the degradation of a myriad of short-lived regulatory proteins (such as p53 in the presence of E6/E6-AP or MDM2, c-Fos, I?B?, p105) and abnormal proteins. UBE2D3 has 88% and 89% sequence identity with UbcH5a and UbcH5b respectively.
|
|
Description
|
Ubiquitin Conjugating Enzyme E2D3 Human Recombinant produced in E.coli is an 18 kDa protein containing 155 amino acids. The UBE2D3 protein contains 6xHis tag and is purified by proprietary chromatographic techniques.
|
|
Source
|
Escherichia Coli.
|
|
Physical Appearance
|
Sterile Filtered white lyophilized powder.
|
|
Formulation
|
Lyophilized from a 0.2μm filtered concentrated (1 mg/ml) solution in 1X PBS and 1mM DTT, pH 7.5.
|
|
Solubility
|
It is recommended to reconstitute the lyophilized UBE2D3 in sterile water not less than 100µg/ml, which can then be further diluted to other aqueous solutions.
|
|
Stability
|
Lyophilized UBE2D3 although stable at room temperature for 3 weeks, should be stored desiccated below -18°C. Upon reconstitution UBE2D3 should be stored at 4°C between 2-7 days and for future use below -18°C. For long term storage it is recommended to add a carrier protein (0.1% HSA or BSA). Please prevent freeze-thaw cycles.
|
|
Purity
|
Greater than 95.0% as determined by(a) Analysis by RP-HPLC. (b) Analysis by SDS-PAGE.
|
|
Amino acid sequence
|
MHHHHHHAMALKRINKELSDLARDPPAQCSAGPVGDDMFHWQATIMG PNDSPYQGGVFFLTIHFPTDYPFKPPKVAFTTRIYHPNINSNGSICLDILR SQWSPALTISKVLLSICSLLCDPNPDDPLVPEIARIYKTDRDKYNRISRE WTQKYAM.
|
|
Usage
|
Prospec's products are furnished for LABORATORY RESEARCH USE ONLY. They may not be used as drugs, agricultural or pesticidal products, food additives or household chemicals.
|
|
Related Products
|
|
|
|
|
|
|
| Contact Us |
 |
Toll Free Phone: 1-(866)-245-0885 Toll Free Fax: 1-(866)-796-4944 Postal Address: PO Box 6591, East Brunswick, 08816 NJ |
 |
Toll Free Phone: 00-800-800-66666 Toll Free Fax: 00-800-800-67890 |
 |
International Phone: +972-8-9471175 International Fax: +972-8-9460534 Postal Address: PO Box 4157, Ness-Ziona, 74140 Israel
|
|
 |
Website : www.prospecbio.com Email: info@prospecbio.com |
|
|
|
|
|
|
|