|
Ubiquitin-conjugating enzyme E2 C, EC 6.3.2.19, Ubiquitin-protein ligase C, Ubiquitin carrier protein C, Ubc10, UBCH10, dJ447F3.2.
UbcH10 is an essential mediator of mitotic destruction events and cell cycle progression. It catalyzes the destruction of cyclins A and B in conjunction with the anaphase-promoting complex, and therefore, plays an important role in the control of the cell exit from mitosis This activity is essential at then end of mitosis for the inactivation of their partner kinase Cdc2 and exit from mitosis into G1 of the next cell cycle. In addition, UbcH10 bears homology to yeast PAS2, a gene that is essential for biogenesis of peroxisomes. UbcH10 is useful for in vitro ubiquitinylation reactions.
Ubiquitin Conjugating Enzyme 10 Human Recombinant produced in E.coli is a 21.1 kDa protein containing 191 amino acids.
The Ubc10 protein contains 6xHis tag and is purified by proprietary chromatographic techniques.
Escherichia Coli.
Sterile Filtered white lyophilized powder.
Lyophilized from a 0.2μm filtered concentrated (1 mg/ml) solution in 1X PBS and 1mM DTT, pH 7.5.
It is recommended to reconstitute the lyophilized Ubc10 in sterile water not less than 100µg/ml, which can then be further diluted to other aqueous solutions
Lyophilized Ubc10 although stable at room temperature for 3 weeks, should be stored desiccated below -18°C. Upon reconstitution Ubc10 should be stored at 4°C between 2-7 days and for future use below -18°C.
For long term storage it is recommended to add a carrier protein (0.1% HSA or BSA).
Please prevent freeze-thaw cycles.
Greater than 95.0% as determined by:
(a) Analysis by RP-HPLC.
(b) Analysis by SDS-PAGE.
MHHHHHHAMGIRMASQNRDPAATSVAAARKGAEPSGGAARGPVGKRLQQELMT LMMSGDKGISAFPESDNLFKWVGTIHGAAGTVYEDLRYKLSLEFPSGYPYNAPT
VKFLTPCYHPNVDTQGNICLDILKEKWSALYDVRTILLSIQSLLGEPNIDSPLNTHA
AELWKNPTAFKKYLQESKQVTSQEP.
Prospec's products are furnished for LABORATORY RESEARCH USE ONLY.They may not be used as drugs,agricultural or pesticidal products, food additives or household chemicals.
|
