|
|
|
|
|
|
|
|
|
|
|
|
|
Catalogue Number
|
ANT-035
|
|
Synonyms
|
Transforming growth factor, beta 2, cetermin, Glioblastoma-derived T-cell suppressor factor, polyergin, G-TSF, TGF-beta2, TGF-beta-2, transforming growth factor beta-2, BSC-1 cell growth inhibitor, TGFB-2.
|
|
Type
|
Polyclonal Rabbit Antibody.
|
|
Introduction
|
TGFB2 is a 27.08 kDa protein having two identical 118 amino acid peptide chains linked by a single disulfide bond. TGFB2 is part of a family of five related cytokines that have an extensive variation of normal and neoplastic cells, indicating the importance of these homo-dimmer proteins as multi-functional regulators of cellular activity. The three mammalian isoforms of TGF-b (TGFb1, TGFb2 and TGFb3) signal through the same receptor and stimulate similar biological responses. They are involved in physiological processes as embryogenesis, tissue remodelling and wound healing.
|
|
Purity
|
Greater than 98%.
|
|
Immunogen
|
IgG Anti Human TGFb-2 is developed in rabbit using recombinant Human TGFb-2 produced in plants.
|
|
Antigen Amino Acid Sequence
|
ALDAAYCFRNVQDNCCLRPLYIDFKRDLGWKWIHEPKGYNANFCAGACPYLWSSDTQHSRVLSLYNTINPEA
SASPCCVSQDLEPLTILYYIGKTPKIEQLSNMIVKSCKCS
|
|
Purification Method
|
Purified IgG prepared by affinity chromatography on protein G.
|
|
Protein formulation
|
Lyophilized from a sterile filtered (0.2µm) solution containing phosphate buffered saline.
|
|
Solubility
|
Add distilled water at 1:2 ratio and let the lyophilized pellet dissolve completely.
|
|
Stability/Storage
|
Store at -20°C. For long term storage freezes in working aliquots at -20°C.
Repeated freezing and thawing is not recommended.
|
|
Applications
|
Western Blot: to detect human TGFb2 by WB analysis this antibody can be used in a dilution of 1/1,000.
|
|
Usage
|
ProSpec's products are furnished for LABORATORY RESEARCH USE ONLY. The product may not be used as drugs, agricultural or pesticidal products, food additives or household chemicals.
|
|
Related Products
|
|
|
|
|
|
|
| Contact Us |
 |
Toll Free Phone: 1-(866)-245-0885
Toll Free Fax: 1-(866)-796-4944
Postal Address: PO Box 6591,
East Brunswick, 08816 NJ |
 |
Toll Free Phone: 00-800-800-66666
Toll Free Fax: 00-800-800-67890 |
 |
International Phone: +972-8-9471175
International Fax: +972-8-9460534
Postal Address: PO Box 4157,
Ness-Ziona, 74140 Israel
|
|
 |
Website : www.prospecbio.com
Email: info@prospecbio.com |
|
|
|
|
|
|
|