ProSpec | Recombinant Protein Manufacturer
0 items|0 $
Protein Catalog
Cytokines
Growth Factors
Chemokines
CD Antigens
Neurotrophins
Hormones
Enzymes
Viral Antigens
Recombinant Proteins
Natural Proteins
Monoclonal Antibodies
Polyclonal Antibodies
Protein Catalog >> Enzymes >> Phosphatase >> PPM1A Human
Accession # print add to favorites
Description
Our Price Quantity Shipping  
Protein Phosphatase 1A Alpha Isoform Human Recombinant
Ice Packs
Catalogue Number PKA-222
Synonyms Protein phosphatase 1A, EC 3.1.3.16, Protein phosphatase 2C isoform alpha, PP2C-alpha, IA, PPM1A, PP2CA, MGC9201.
Introduction Protein Phosphatase 2C alpha is a member of the PP2C family of Ser/Thr protein phosphatases. PP2C family members are known to be negative regulators of cell stress response pathways. This phosphatase dephosphorylates, and negatively regulates the activities of, MAP kinases and MAP kinase kinases. It has been shown to inhibit the activation of p38 and JNK kinase cascades induced by environmental stresses. This phosphatase can also dephosphorylate cyclin-dependent kinases, and thus may be involved in cell cycle control. Overexpression of this phosphatase is reported to activate the expression of the tumor suppressor gene TP53/p53, which leads to G2/M cell cycle arrest and apoptosis. Three alternatively spliced transcript variants encoding two distinct isoforms have been described.
Protein phosphatase 2C(PP2C?) is a Mn2+- or Mg2+-dependent protein serine/threonine phosphatase that is essential for regulating cellular stress response in eukaryotes.
Description Protein Phosphatase 1A Alpha Isoform Human Recombinant produced is a single, non-glycosylated polypeptide chain containing 382 amino acids and having a molecular mass of 46.6KDa (containing His tag, T7 gene 10 leader, XpressTM Epitope). The protein coding region of PP2C? (amino acids 1-382) was cloned into an E. coli expression vector(BamHI/Hind? site). PPM1A was overexpressed in E. coli as a soluble His-tag fusion protein, and it was purified by conventional column chromatographic techniques.
Source Escherichia Coli.
Physical Appearance Sterile filtered colorless solution.
Formulation The protein (1mg/ml) In phosphate-buffered saline ( pH 7.4)
Stability Store at 4°C if entire vial will be used within 2-4 weeks.
Store, frozen at -20°C for longer periods of time.
For long term storage it is recommended to add a carrier protein (0.1% HSA or BSA).
Avoid multiple freeze-thaw cycles.
Purity Greater than 95.0% as determined by(a)Analysis by RP-HPLC.
(b)Analysis by SDS-PAGE.
Amino Acid Sequence MRGSHHHHHHGMASMTGGQQMGRDLYDDDDKDRWILMGAFLDKPKMEKHN AQGQGNGLRYGLSSMQGWRVEMEDAHTAVIGLPSGLESWSFFAVYDGHAG SQVAKYCCEHLLDHITNNQDFKGSAGAPSVENVKNGIRTG FLEIDEHMRV MSEKKHGADRSGSTAVGVLISPQHTYFINCGDSRGLLCRNRKVHFFTQDH KPSNPLEKERIQNAGGSVMIQRVNGSLAVSRALGDFDYKCVHGKGPTEQL VSPEPEVHDI ERSEEDDQFI ILACDGIWDVMGNEELCDFVRSRLEVTDDL EKVCNEVVDTCLYKGSRDNMSVILICFPNAPKVSPEAVKKEAELDKYLEC RVEEIIKKQG EGVPDLVHVM RTLASENIPSLPPGGELASKRNVIEAVYNR LNPYKNDDTDSTSTDDMW.
Activity 8,000 U/mg.
Unit Definition One unit will hydrolyze 1nanomole of p-nitrophenylphosphatate per minute at pH 7.4 at 37°C using 10mM of substrate.
Usage Prospec's products are furnished for LABORATORY RESEARCH USE ONLY. The product may not be used as drugs, agricultural or pesticidal products, food additives or household chemicals.
Related Products
» PPM1A Antibody
» PPM1G Human
Contact Us

Toll Free Phone: 1-(866)-245-0885
Toll Free Fax:  1-(866)-796-4944
Postal Address: PO Box 6591,
East Brunswick, 08816 NJ

Toll Free Phone: 00-800-800-66666
Toll Free Fax: 00-800-800-67890

International Phone: +972-8-9471175
International Fax: +972-8-9460534
Postal Address: PO Box 4157,
Ness-Ziona, 74140 Israel

Website : www.prospecbio.com
Email: info@prospecbio.com

 
  Home | Legal | Privacy | Site Map | Cytokines | Growth Factors | Chemokines | CD Antigens | Neurotrophins | Hormones | Enzymes | Recombinant Proteins | Viral Antigens | Monoclonal Antibodies