|
|
|
|
|
|
|
|
|
|
|
|
|
Catalogue Number
|
CYT-582
|
|
Synonyms
|
Otoraplin, Fibrocyte-derived protein, Melanoma inhibitory activity-like protein, OTOR, MIAL, FDP, MIAL1, MGC126737, MGC126739.
|
|
Introduction
|
OTOR proteins is also known as fibrocyte-derived protein (Fdp) and Melanoma inhibitory activity-like (MIAL). Otoraplin is a member of the melanoma-inhibiting activity gene family. Otoraplin is a secreted 16 kDa globular protein that is expressed in the inner ear by periotic mesenchyme and developing and mature fibrocytes. OTOR is highly homologous to MIA/cartilage-derived retinoic acid-sensitive protein (CD-RAP), which is a cartilage-specific protein that is also expressed in malignant melanoma cells. The 111 amino acid mature human otoraplin contains 1 SH3 domain (46 – 107 amino acids) and a Tyr at position 50 that is reportedly sulfated. Otoraplin takes pasrt in the initiation of periotic mesenchyme chondrogenesis. Otoraplin is secreted through the Golgi apparatus and plays a role in cartilage development and maintenance. A frequent polymorphism in the translation start codon of OTOR can abolish translation and may be associated with forms of deafness.
|
|
Description
|
Otoraplin Human Recombinant produced in E.Coli is a single, non-glycosylated, polypeptide chain containing 111 amino acids and having a molecular mass of 12.7 kDa. The OTOR is purified by proprietary chromatographic techniques.
|
|
Source
|
Escherichia Coli.
|
|
Physical Appearance
|
Sterile Filtered White lyophilized (freeze-dried) powder.
|
|
Formulation
|
The OTOR protein was lyophilized from a concentrated (1mg/ml) solution containing 20mM PBS pH-7.4 and 130mM NaCl.
|
|
Solubility
|
It is recommended to reconstitute the lyophilized Otoraplin in sterile 18MΩ-cm H2O not less than 100µg/ml, which can then be further diluted to other aqueous solutions.
|
|
Stability
|
Lyophilized OTOR Recombinant although stable at room temperature for 3 weeks, should be stored desiccated below -18°C. Upon reconstitution OTOR should be stored at 4°C between 2-7 days and for future use below -18°C. For long term storage it is recommended to add a carrier protein (0.1% HSA or BSA). Please prevent freeze-thaw cycles.
|
|
Purity
|
Greater than 98.0% as determined by(a) Analysis by RP-HPLC. (b) Analysis by SDS-PAGE.
|
|
Amino acid sequence
|
VHGIFMDRLASKKLCADDECVYTISLASAQEDYNAPDCRFINVKKGQQIYVYS KLVKENGAGEFWAGSVYGDGQDEMGVVGYFPRNLVKEQRVYQEATKEVPTT DIDFFCE.
|
|
Usage
|
ProSpec's products are furnished for LABORATORY RESEARCH USE ONLY. The product may not be used as drugs, agricultural or pesticidal products, food additives or household chemicals.
|
|
Related Products
|
|
|
|
|
|
|
| Contact Us |
 |
Toll Free Phone: 1-(866)-245-0885 Toll Free Fax: 1-(866)-796-4944 Postal Address: PO Box 6591, East Brunswick, 08816 NJ |
 |
Toll Free Phone: 00-800-800-66666 Toll Free Fax: 00-800-800-67890 |
 |
International Phone: +972-8-9471175 International Fax: +972-8-9460534 Postal Address: PO Box 4157, Ness-Ziona, 74140 Israel
|
|
 |
Website : www.prospecbio.com Email: info@prospecbio.com |
|
|
|
|
|
|
|