ProSpec | Recombinant Protein Manufacturer
Search by name or Catalog #:
 
0 items|0 $
Protein Catalog
Cytokines
Growth Factors
Chemokines
CD Antigens
Neurotrophins
Hormones
Enzymes
Viral Antigens
Recombinant Proteins
Natural Proteins
Monoclonal Antibodies
Polyclonal Antibodies
Protein Catalog >> Cytokines >> Other >> OTOR Human
Accession # print send to friend add to favorites
Description
Our Price Quantity Shipping  
Otoraplin Human Recombinant
 
Catalogue Number CYT-582
Synonyms Otoraplin, Fibrocyte-derived protein, Melanoma inhibitory activity-like protein, OTOR, MIAL, FDP, MIAL1, MGC126737, MGC126739.
Introduction OTOR proteins is also known as fibrocyte-derived protein (Fdp) and Melanoma inhibitory activity-like (MIAL). Otoraplin is a member of the melanoma-inhibiting activity gene family. Otoraplin is a secreted 16 kDa globular protein that is expressed in the inner ear by periotic mesenchyme and developing and mature fibrocytes. OTOR is highly homologous to MIA/cartilage-derived retinoic acid-sensitive protein (CD-RAP), which is a cartilage-specific protein that is also expressed in malignant melanoma cells. The 111 amino acid mature human otoraplin contains 1 SH3 domain (46 – 107 amino acids) and a Tyr at position 50 that is reportedly sulfated. Otoraplin takes pasrt in the initiation of periotic mesenchyme chondrogenesis.
Otoraplin is secreted through the Golgi apparatus and plays a role in cartilage development and maintenance. A frequent polymorphism in the translation start codon of OTOR can abolish translation and may be associated with forms of deafness.
Description Otoraplin Human Recombinant produced in E.Coli is a single, non-glycosylated, polypeptide chain containing 111 amino acids and having a molecular mass of 12.7 kDa.
The OTOR is purified by proprietary chromatographic techniques.
Source Escherichia Coli.
Physical Appearance Sterile Filtered White lyophilized (freeze-dried) powder.
Formulation The OTOR protein was lyophilized from a concentrated (1mg/ml) solution containing 20mM PBS pH-7.4 and 130mM NaCl.
Solubility It is recommended to reconstitute the lyophilized Otoraplin in sterile 18MΩ-cm H2O not less than 100µg/ml, which can then be further diluted to other aqueous solutions.
Stability Lyophilized OTOR Recombinant although stable at room temperature for 3 weeks, should be stored desiccated below -18°C. Upon reconstitution OTOR should be stored at 4°C between 2-7 days and for future use below -18°C.
For long term storage it is recommended to add a carrier protein (0.1% HSA or BSA).
Please prevent freeze-thaw cycles.
Purity Greater than 98.0% as determined by(a) Analysis by RP-HPLC.
(b) Analysis by SDS-PAGE.
Amino acid sequence VHGIFMDRLASKKLCADDECVYTISLASAQEDYNAPDCRFINVKKGQQIYVYS
KLVKENGAGEFWAGSVYGDGQDEMGVVGYFPRNLVKEQRVYQEATKEVPTT
DIDFFCE.
Usage ProSpec's products are furnished for LABORATORY RESEARCH USE ONLY. The product may not be used as drugs, agricultural or pesticidal products, food additives or household chemicals.
Related Products
Contact Us

Toll Free Phone: 1-(866)-245-0885
Toll Free Fax:  1-(866)-796-4944
Postal Address: PO Box 6591,
East Brunswick, 08816 NJ

Toll Free Phone: 00-800-800-66666
Toll Free Fax: 00-800-800-67890

International Phone: +972-8-9471175
International Fax: +972-8-9460534
Postal Address: PO Box 4157,
Ness-Ziona, 74140 Israel

Website : www.prospecbio.com
Email: info@prospecbio.com

 
  Home | Legal | Privacy | Site Map | Cytokines | Growth Factors | Chemokines | CD Antigens | Neurotrophins | Hormones | Enzymes | Recombinant Proteins | Viral Antigens | Monoclonal Antibodies