ProSpec | Recombinant Protein Manufacturer
0 items|0 $
Protein Catalog
Cytokines
Growth Factors
Chemokines
CD Antigens
Neurotrophins
Hormones
Enzymes
Viral Antigens
Recombinant Proteins
Natural Proteins
Monoclonal Antibodies
Polyclonal Antibodies
Protein Catalog >> Growth Factors >> OPG Fc Human
Accession # print add to favorites
Description
Our Price Quantity Shipping  
Osteoprotegerin Human Recombinant /Fc Chimera
 
Catalogue Number CYT-266
Synonyms TNFRSF11B, OPG, OCIF, Osteoclastogenesis inhibitory factor, TR1, MGC29565.
Introduction Osteoprotegerin acts as decoy receptor for rankl and thereby neutralizes its function in osteoclastogenesis. OPG inhibits the activation of osteoclasts and promotes osteoclast apoptosis in vitro. Bone homeostasis seems to depend on the local rankl/opg ratio. Osteoprotegerin may also play a role in preventing arterial calcification. May act as decoy receptor for trail and protect against apoptosis. Trail binding blocks the inhibition of osteoclastogenesis.
Description Recombinant OPG produced in yeast contains 412 amino acid residues, including 180 residues from mature OPG (a.a 22-201) and 232 residues from the Fc protein of human IgG1, and has a calculated molecular mass of 46.5 kDa. As a result of glycosylation, the recombinant Osteoprotegrin migrates as a 49 kDa protein in SDS-PAGE under reducing conditions.
The OPG is purified by proprietary chromatographic techniques.
Amino Acid Sequence AA Sequence: OPG 22-201: ETFPPKYLHYDEETSHQLLCDKCPPGTYLKQHCTAKWKTVCAPCPDHYY
TDSWHTSDECLYCSPVCKELQYVKQECNRTHNRVCECKEGRYLEIEFCL
KHRSCPPGFGVVQAGTPERNTVCKRCPDGFFSNETSSKAPCRKHTNCS
VFGLLLTQKGNATHDNICSGNSESTQKCGIDVTL.
Fc232 : EPKSSDKTHTCPPCPAPEFEGAPSVFLFPPKPKDTLMISRTPEVTCVVVDV
SHEDPEVKFNWYVDGVEVHNAKTKPREEQYNSTYRVVSVLTVLHQDWLN
GKEYKCKVSNKALPTPIEKTISKAKGQREPQVYTLPPSRDELTKNQVSLTC
LVKGFYPSDIAVEWESNGQPENNYKTTPPVLDSDGSFFLYSKLTVDKSRW
QQGNVFSCSVMHEALHNHYTQKSLSLSPGK.
Source Pichia Pastoris.
Physical Appearance Sterile Filtered White lyophilized (freeze-dried) powder.
Formulation OPG was lyophilized from a 0.2μm filtered concentrated (0.5mg/ml) solution in PBS, pH= 7.4.
Solubility It is recommended to reconstitute the lyophilized Osteoprotegerin in sterile 18MΩ-cm H2O not less than 100µg/ml, which can then be further diluted to other aqueous solutions.
Stability Lyophilized Osteoprotegerin although stable at room temperature for 3 weeks, should be stored desiccated below -18°C. Upon reconstitution OCIF should be stored at 4°C between 2-7 days and for future use below -18°C. For long term storage it is recommended to add a carrier protein (0.1% HSA or BSA).
Please prevent freeze-thaw cycles.
Purity Greater than 90.0% as determined by(a) Analysis by RP-HPLC.
(b) Analysis by SDS-PAGE.
Biological Activity Determined by its ability to neutralize the stimulation of U937 cells treated with 10ng/ml of soluble RANKL (sRANKL) corresponding to a Specific Activity of 100,000IU/mg.
Usage Prospec's products are furnished for LABORATORY RESEARCH USE ONLY. They may not be used as drugs, agricultural or pesticidal products, food additives or household chemicals.
Related Products
» OPG Human
» OPG Human, Hi-5
» OPG Human, His
Contact Us

Toll Free Phone: 1-(866)-245-0885
Toll Free Fax:  1-(866)-796-4944
Postal Address: PO Box 6591,
East Brunswick, 08816 NJ

Toll Free Phone: 00-800-800-66666
Toll Free Fax: 00-800-800-67890

International Phone: +972-8-9471175
International Fax: +972-8-9460534
Postal Address: PO Box 4157,
Ness-Ziona, 74140 Israel

Website : www.prospecbio.com
Email: info@prospecbio.com

 
  Home | Legal | Privacy | Site Map | Cytokines | Growth Factors | Chemokines | CD Antigens | Neurotrophins | Hormones | Enzymes | Recombinant Proteins | Viral Antigens | Monoclonal Antibodies