|
|
|
|
|
|
|
|
|
|
|
|
|
Catalogue Number
|
CYT-369
|
|
Synonyms
|
NPPB, Natriuretic Peptide Precursor B, BNP, B-type Natriuretic Peptide.
|
|
Introduction
|
Natriuretic Peptide Precursor B acts as a cardiac hormone with a variety of biological actions including natriuresis, diuresis, vasorelaxation, and inhibition of renin and aldosterone secretion. It is thought to play a key role in cardiovascular homeostasis. Helps restore the body's salt and water balance. Improves heart function.
|
|
Description
|
B-type Natriuretic Peptide Human is a polypeptide chain containing 32 amino acids and having a molecular mass of 3464 Dalton.
|
|
Physical Appearance
|
Sterile Filtered White lyophilized (freeze-dried) powder.
|
|
Formulation
|
The protein was lyophilized without additives.
|
|
Solubility
|
It is recommended to reconstitute the lyophilized B-type Natriuretic Peptide in sterile 18MΩ-cm H2O not less than 100µg/ml, which can then be further diluted to other aqueous solutions.
|
|
Stability
|
Lyophilized B-type Natriuretic Peptide although stable at room temperature for 3 weeks, should be stored desiccated below -18°C. Upon reconstitution B-type Natriuretic Peptide should be stored at 4°C between 2-7 days and for future use below -18°C. For long term storage it is recommended to add a carrier protein (0.1% HSA or BSA). Please prevent freeze-thaw cycles.
|
|
Purity
|
Greater than 98.0% as determined by(a) Analysis by RP-HPLC. (b) Analysis by SDS-PAGE.
|
|
Amino acid sequence
|
SPKMVQGSGCFGRKMDRISSSSGLGCKVLRRH-OH.
|
|
Usage
|
Prospec's products are furnished for LABORATORY RESEARCH USE ONLY. The product may not be used as drugs, agricultural or pesticidal products, food additives or household chemicals.
|
|
Related Products
|
|
|
|
|
|
|
| Contact Us |
 |
Toll Free Phone: 1-(866)-245-0885 Toll Free Fax: 1-(866)-796-4944 Postal Address: PO Box 6591, East Brunswick, 08816 NJ |
 |
Toll Free Phone: 00-800-800-66666 Toll Free Fax: 00-800-800-67890 |
 |
International Phone: +972-8-9471175 International Fax: +972-8-9460534 Postal Address: PO Box 4157, Ness-Ziona, 74140 Israel
|
|
 |
Website : www.prospecbio.com Email: info@prospecbio.com |
|
|
|
|
|
|
|