|
|
|
|
|
|
|
|
|
|
|
|
|
Catalogue Number
|
PRO-466
|
|
Synonyms
|
Myelin Oligodendrocyte Glycoprotein, MOG, MOGIG-2, MGC26137.
|
|
Introduction
|
Myelin Oligodendrocyte Glycoprotein is a membrane protein expressed on the oligodendrocyte cell surface and the outermost surface of myelin sheaths. Due to this localization, it is a prime target antigen that plays a role in immune-mediated demyelination. Myelin Oligodendrocyte Glycoprotein is involved in completion and maintenance of the myelin sheath and in cell-cell communication. MOG protein was found to differentially expressed in the dorsolateral prefrontal cortex and in the temporal lobe from patients with schizophrenia. MOG-specific antibody is crucial to the initiation of MOG-induced murine experimental autoimmune encephalomyelitis.
|
|
Description
|
Myelin Oligodendrocyte Glycoprotein produced in E.Coli is a single, non-glycosylated polypeptide chain containing a total of 132 amino acids (Met + 30-154 a.a. + 6x His tag at C-terminus) and having a total molecular mass of 15.2 kDa.
|
|
Source
|
Escherichia Coli.
|
|
Physical Appearance
|
Sterile Filtered White lyophilized (freeze-dried) powder.
|
|
Formulation
|
The Myelin Oligodendrocyte Glycoprotein 0.5mg/ml solution was lyophilized from 20mM sodium acetate buffer pH-4 and 0.3M sodium chloride.
|
|
Solubility
|
It is recommended to reconstitute the lyophilized MOG in sterile 10mM Acetic acid not less than 100µg/ml, which can then be further diluted to other aqueous solutions.
|
|
Stability
|
Lyophilized MOG although stable at room temperature for 3 weeks, should be stored desiccated below -18°C. Upon reconstitution MOG should be stored at 4°C between 2-7 days and for future use below -18°C. For long term storage it is recommended to add a carrier protein (0.1% HSA or BSA). Please prevent freeze-thaw cycles.
|
|
Recommended Applications
|
5-20µg per ml for In-Vitro Experiments and 50-100µg per animal for In-Vivo study. The protein can be used for T-cell proliferation, cytokine induction, antigen presentation, western blotting, ELISA and EAE induction in mice.
|
|
Purity
|
Greater than 95.0% as determined by(a) Analysis by RP-HPLC. (b) Analysis by SDS-PAGE.
|
|
Amino Acid Sequence
|
MGQFRVIGPRHPIRALVGDEVELPCRISPGKNATGMEVGWYRPPFSRVVHLYRN GKDQDGDQAPEYRGRTELLKDAIGEGKVTLRIRNVRFSDEGGFTCFFRDHSYQE EAAMELKVEDPFYWVSPGHHHHHH.
|
|
Usage
|
Prospec's products are furnished for LABORATORY RESEARCH USE ONLY. The product may not be used as drugs, agricultural or pesticidal products, food additives or household chemicals.
|
|
Related Products
|
|
|
|
|
|
|
| Contact Us |
 |
Toll Free Phone: 1-(866)-245-0885 Toll Free Fax: 1-(866)-796-4944 Postal Address: PO Box 6591, East Brunswick, 08816 NJ |
 |
Toll Free Phone: 00-800-800-66666 Toll Free Fax: 00-800-800-67890 |
 |
International Phone: +972-8-9471175 International Fax: +972-8-9460534 Postal Address: PO Box 4157, Ness-Ziona, 74140 Israel
|
|
 |
Website : www.prospecbio.com Email: info@prospecbio.com |
|
|
|
|
|
|
|