|
Melanoma-derived growth regulatory protein precursor, Cartilage-derived retinoic acid-sensitive protein, CD-RAP, MIA.
The Melanoma Inhibitory protein (MIA) was identified as an inhibitor of in vitro growth of malignant melanoma cells. The protein contains a SH3 domain.
MIA acts as a potent tumor cell growth inhibitor for malignant melanoma cells and some other neuroectodermal tumors, including gliomas, in an autocrine fashion. In a study of human melanoma cell lines with different metastatic capacity MIA mRNA expression appeared to be inversely correlated with pigmentation. MIA has been shown to represent a very sensitive and specific serum marker for systemic malignant melanoma that might be useful for staging of primary melanomas, detection of progression from localized to metastatic disease during follow-up, and monitoring therapy of advanced melanomas.
Melanoma Inhibitory Activity Human Recombinant produced in E.Coli is a single, non-glycosylated, polypeptide chain consisting of 108 amino having a total molecular mass of 12237 Dalton.
The MIA is purified by proprietary chromatographic techniques.
Escherichia Coli.
Sterile Filtered White lyophilized (freeze-dried) powder.
The protein was lyophilized from a concentrated (1.66mg/ml) solution containing 20mM Potassium-phosphate pH=7 and 150mM potassium chloride.
It is recommended to reconstitute the lyophilized Melanoma Inhibitory Activity in sterile 18MΩ-cm H2O not less than 100µg/ml, which can then be further diluted to other aqueous solutions.
Lyophilized MIA although stable at room temperature for 3 weeks, should be stored desiccated below -18°C. Upon reconstitution MIA should be stored at 4°C between 2-7 days and for future use below -18°C.
Please prevent freeze-thaw cycles.
Greater than 95.0% as determined by:
(a) Analysis by RP-HPLC.
(b) Analysis by SDS-PAGE.
Agrees with the sequence of native MIA human with an addition N-terminal Methionine residue.
MGPMPKLADRKLCADQECSSHPISMAVALQDYMAPDCRFLTIHRGQVV
YVFSLKGRGRFLWGGSVQGDYYGDLAARLGYFPSSIVREDQTLKVDVKT
DKWDFYCQ.
The biological activity is calculated by the inhibiting effect on the invasion of Mel In Tumor cells (Bosserhoff et al.2003 Lab Invest. 83, 1583-94) and found active in Mel In assay.
UV spectroscopy at 280 nm using the absorption coefficient of 19300 M-1cm-1 .
ProSpec's products are furnished forLABORATORY RESEARCHUSEONLY. The product may not be used as drugs, agricultural or pesticidal products, food additives or household chemicals.
Blesch A et al Cloning of a novel malignant melanoma-derived growth-regulatory protein, MIA. Cancer Research 54(21): 5695-5701 (1994); Bogdahn U et al Autocrine tumor cell growth-inhibiting activities from human malignant melanoma. Cancer Research 49(19): 5358-5363 (1989); Bosserhoff AK et al Structure and promoter analysis of the gene encoding the human melanoma-inhibiting protein MIA. Journal of Biological Chemistry 271(1): 490-495 (1965); Koehler MR et al Assignment of the human melanoma inhibitory activity gene (MIA) to 19q13.32-q13.33 by fluorescence in situ hybridization (FISH). Genomics 35(1): 265-267 (1996); van Groningen JJ et al Identification of melanoma inhibitory activity and other differentially expressed messenger RNAs in human melanoma cell lines with different metastatic capacity by messenger RNA differential display. Cancer Research 55(24): 6237-6243 (1995)
|
