|
|
|
|
|
|
|
|
|
|
|
|
|
Catalogue Number
|
CHM-261
|
|
Synonyms
|
IL-8, CXCL8, Monocyte-derived neutrophil chemotactic factor, MDNCF, T-cell chemotactic factor, Neutrophil-activating protein 1, NAP-1, Protein 3-10C, Granulocyte chemotactic protein 1, GCP-1, Monocyte-derived neutrophil-activating peptide, MONAP, Emoctakin, K60, NAF, LECT, LUCT, 3-10C, LYNAP, SCYB8, TSG-1, AMCF-I, b-ENAP.
|
|
Introduction
|
Interleukin-8 (IL-8) is a chemokine produced by macrophages and other cell types such as epithelial cells. It is also synthesized by endothelial cells, which store IL-8 in their storage vesicles, the Weibel-Palade bodies. When first encountering an antigen, the primary cells to encounter it are the macrophages who phagocytose the particle. Upon processing, they release chemokines to signal other immune cells to come in to the site of inflammation. IL-8 is one such chemokine. It serves as a chemical signal that attracts neutrophils at the site of inflammation, and therefore is also known as Neutrophil Chemotactic Factor.
|
|
Description
|
IL-8 Rabbit Recombinant is a full length secreted protein (79 amino acids - a.a. 23-101). The IL-8 is expressed in E.Coli. and fused to a N-terminal His tag, having a total MW of 12.24kDa.
|
|
Source
|
Escherichia Coli.
|
|
Physical Appearance
|
Sterile Filtered colorless solution.
|
|
Formulation
|
The IL-8 solution (1mg/ml) contains 50mM Tris, 300mM NaCl, 10% Glycerol, pH 7.5.
|
|
Stability
|
IL-8 although stable 4°C for 4 weeks, should be stored desiccated below -18°C.
For long term storage it is recommended to add a carrier protein (0.1% HSA or BSA).
Please prevent freeze-thaw cycles.
|
|
Purity
|
Greater than 90% as determined by SDS-PAGE.
|
|
Amino acid sequence
|
AVLTRIGTELRCQCIKTHSTPFHPKFIKELRVIESGPHCANSEIIVKLVDGRELCLDPKEKWVQKVV
QIFLKRAEQQES
|
|
Usage
|
Prospec's products are furnished for LABORATORY RESEARCH USE ONLY. The product may not be used as drugs, agricultural or pesticidal products, food additives or household chemicals.
|
|
Related Products
|
|
|
|
|
|
|
| Contact Us |
 |
Toll Free Phone: 1-(866)-245-0885
Toll Free Fax: 1-(866)-796-4944
Postal Address: PO Box 6591,
East Brunswick, 08816 NJ |
 |
Toll Free Phone: 00-800-800-66666
Toll Free Fax: 00-800-800-67890 |
 |
International Phone: +972-8-9471175
International Fax: +972-8-9460534
Postal Address: PO Box 4157,
Ness-Ziona, 74140 Israel
|
|
 |
Website : www.prospecbio.com
Email: info@prospecbio.com |
|
|
|
|
|
|
|