|
|
|
|
|
|
|
|
|
|
|
|
|
Catalogue Number
|
ANT-034
|
|
Synonyms
|
Leukocyte interferon, B cell interferon, Type I interferon, IFNA2, IFN-a 2a.
|
|
Type
|
Polyclonal Rabbit Antibody.
|
|
Introduction
|
IFN-alpha is produced by macrophages and has antiviral activities. Interferon stimulates the production of two enzymes: protein kinase and an oligoadenylate synthetase.
|
|
Purity
|
Greater than 98%.
|
|
Immunogen
|
IgG Anti Human Interferon a 2a is developed in rabbit using recombinant Human Interferon a 2a expressed in plants.
|
|
Antigen Amino Acid Sequence
|
CDLPQTHSLGSRRTLMLLAQMRKISLFSCLKDRHDFGFPQEEFGNQFQKAETIPVLHEMIQQ IFNLFSTKDSSAAWDETLLDKFYTELYQQLNDLEACVIQGVGVTETPLMNEDSILAVRKYFQR ITLYLKEKKYSPCAWEVVRAEIMRSFSLSTNLQESLRSKE
|
|
Purification Method
|
Purified IgG prepared by affinity chromatography on protein G.
|
|
Protein formulation
|
Lyophilized from a sterile filtered (0.2µm) solution containing phosphate buffered saline.
|
|
Solubility
|
Add distilled water at 1:2 ratio and let the lyophilized pellet dissolve completely.
|
|
Stability/Storage
|
Store at -20°C. For long term storage freezes in working aliquots at -20°C. Repeated freezing and thawing is not recommended.
|
|
Applications
|
ELISA: to detect Human Interferon a 2a by indirect ELISA a dilution of at least 1/1,000 of this antibody is required. This antibody, in conjunction with compatible secondary reagents (anti rabbit AP conjugated), allows the detection of 0.2-1 ng /well of human Interferon a 2a. Western Blot: to detect human Interferon a2a by WB analysis this antibody can be used in a dilution of 1/1,500.
|
|
Usage
|
ProSpec's products are furnished for LABORATORY RESEARCH USE ONLY. The product may not be used as drugs, agricultural or pesticidal products, food additives or household chemicals.
|
|
Related Products
|
|
|
|
|
|
|
| Contact Us |
 |
Toll Free Phone: 1-(866)-245-0885 Toll Free Fax: 1-(866)-796-4944 Postal Address: PO Box 6591, East Brunswick, 08816 NJ |
 |
Toll Free Phone: 00-800-800-66666 Toll Free Fax: 00-800-800-67890 |
 |
International Phone: +972-8-9471175 International Fax: +972-8-9460534 Postal Address: PO Box 4157, Ness-Ziona, 74140 Israel
|
|
 |
Website : www.prospecbio.com Email: info@prospecbio.com |
|
|
|
|
|
|
|