ProSpec | Recombinant Protein Manufacturer
Search by name or Catalog #:
 
0 items|0 $
Protein Catalog
Cytokines
Growth Factors
Chemokines
CD Antigens
Neurotrophins
Hormones
Enzymes
Viral Antigens
Recombinant Proteins
Natural Proteins
Monoclonal Antibodies
Polyclonal Antibodies
Protein Catalog >> Polyclonal Antibodies >> Other >> IFN a 2a Antibody
print send to friend add to favorites
Description
Our Price Quantity Shipping  
Interferon a 2a Polyclonal Rabbit Anti-Human Antibody
Ice Packs
Catalogue Number ANT-034
Synonyms Leukocyte interferon, B cell interferon, Type I interferon, IFNA2, IFN-a 2a.
Type Polyclonal Rabbit Antibody.
Introduction IFN-alpha is produced by macrophages and has antiviral activities. Interferon stimulates the production of two enzymes: protein kinase and an oligoadenylate synthetase.
Purity Greater than 98%.
Immunogen IgG Anti Human Interferon a 2a is developed in rabbit using recombinant Human Interferon a 2a expressed in plants.
Antigen Amino Acid Sequence CDLPQTHSLGSRRTLMLLAQMRKISLFSCLKDRHDFGFPQEEFGNQFQKAETIPVLHEMIQQ
IFNLFSTKDSSAAWDETLLDKFYTELYQQLNDLEACVIQGVGVTETPLMNEDSILAVRKYFQR
ITLYLKEKKYSPCAWEVVRAEIMRSFSLSTNLQESLRSKE
Purification Method Purified IgG prepared by affinity chromatography on protein G.
Protein formulation Lyophilized from a sterile filtered (0.2µm) solution containing phosphate buffered saline.
Solubility Add distilled water at 1:2 ratio and let the lyophilized pellet dissolve completely.
Stability/Storage Store at -20°C. For long term storage freezes in working aliquots at -20°C.
Repeated freezing and thawing is not recommended.
Applications ELISA: to detect Human Interferon a 2a by indirect ELISA a dilution of at least 1/1,000 of this antibody is required. This antibody, in conjunction with compatible secondary reagents (anti rabbit AP conjugated), allows the detection of 0.2-1 ng /well of human Interferon a 2a.
Western Blot: to detect human Interferon a2a by WB analysis this antibody can be used in a dilution of 1/1,500.
Usage ProSpec's products are furnished for LABORATORY RESEARCH USE ONLY. The product may not be used as drugs, agricultural or pesticidal products, food additives or household chemicals.
Related Products
» IFN a 2a Human
» IFN a 2a Human, HEK
» IFN a 2a Human, Plant
» IFN A Neut Antibody
» IFN A WB Antibody
Contact Us

Toll Free Phone: 1-(866)-245-0885
Toll Free Fax:  1-(866)-796-4944
Postal Address: PO Box 6591,
East Brunswick, 08816 NJ

Toll Free Phone: 00-800-800-66666
Toll Free Fax: 00-800-800-67890

International Phone: +972-8-9471175
International Fax: +972-8-9460534
Postal Address: PO Box 4157,
Ness-Ziona, 74140 Israel

Website : www.prospecbio.com
Email: info@prospecbio.com

 
  Home | Legal | Privacy | Site Map | Cytokines | Growth Factors | Chemokines | CD Antigens | Neurotrophins | Hormones | Enzymes | Recombinant Proteins | Viral Antigens | Monoclonal Antibodies