ProSpec | Recombinant Protein Manufacturer
Search by name or Catalog #:
 
0 items|0 $
Protein Catalog
Cytokines
Growth Factors
Chemokines
CD Antigens
Neurotrophins
Hormones
Enzymes
Viral Antigens
Recombinant Proteins
Natural Proteins
Monoclonal Antibodies
Polyclonal Antibodies
Protein Catalog >> Viral Antigens >> HBsAg >> HBsAg preS1
print send to friend add to favorites
Description
Our Price Quantity Shipping  
Hepatitis B Surface Antigen, preS1 Recombinant
 
Catalogue Number HBS-871
Introduction Hepatitis B virus (HBV) is a human pathogen, causing serious liver disease. The HBV surface protein antigens (HBsAg) are comprised of three carboxyl co terminal HBs proteins termed large (LHBs), middle (MHBs) and small (SHBs, also called major) protein. LHBs and MHBs also share the highly hydrophobic, repetitive, membrane spanning S domain. In addition, LHBs has a 119 amino acid region called preS1.
Description The E.Coli derived Recombinant Hepatitis B Surface Antigen preS1 is a single non-glycosylated polypeptide chain containing 119 amino acids and having a molecular weight of 12.6 kDa.
Purification Method HBsAg protein was purified by proprietary chromatographic technique.
Purity HBsAg Protein is >95% pure as determined by 10% PAGE (coomassie staining).
Formulation HBsAg protein was lyophilized from 0.2μm filtered (1mg/ml) solution in 20mM PB, pH 7.4, and 50mM NaCl.
Applications 1. Immunochromatography (capture and conjugate).
2. Preparing monoclonal or polyclonal antibodies for HBsAg-preS1.
3. ELISA.
Solubility We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Reconstitute in sterile distilled water or aqueous buffer containing 0.1% BSA to a concentration of 0.1-1.0 mg/mL. Stock solutions should be apportioned into working aliquots and stored at <-20°C. Further dilutions should be made in appropriate buffered solutions.
Storage This lyophilized HBsAg preparation is stable at 2-8°C, but should be kept at -20°C for long term storage, preferably desiccated. Upon reconstitution, the preparation is stable for up to one week at 2-8°C. For maximal stability, apportion the reconstituted preparation into working aliquots and store at -20°C to -70°C.
Avoid repeated freeze/thaw cycles.
Amino Acid Sequence MGGWSSKPRQGMGTNLSVPNPLGFFPDHQLDPAFGAN
SNNPDWDFNPNKDHWPEAHQVGAGAFGPGFTPPHGGLLGWSP
QAQGILTTVPVAPPPASTNRQSGRQPTPISPPLRDSHPQA.
Related Products
» HBsAg antibody
» HBsAg preS2
» HBsAgA Antibody
Contact Us

Toll Free Phone: 1-(866)-245-0885
Toll Free Fax:  1-(866)-796-4944
Postal Address: PO Box 6591,
East Brunswick, 08816 NJ

Toll Free Phone: 00-800-800-66666
Toll Free Fax: 00-800-800-67890

International Phone: +972-8-9471175
International Fax: +972-8-9460534
Postal Address: PO Box 4157,
Ness-Ziona, 74140 Israel

Website : www.prospecbio.com
Email: info@prospecbio.com

 
  Home | Legal | Privacy | Site Map | Cytokines | Growth Factors | Chemokines | CD Antigens | Neurotrophins | Hormones | Enzymes | Recombinant Proteins | Viral Antigens | Monoclonal Antibodies