|
Group XIIA secretory phospholipase A2, EC 3.1.1.4, Phosphatidylcholine 2-acylhydrolase GXII, GXII sPLA2, PLA2G12, sPLA2-XII.
Phospholipase A2 (PLA2) catalyzes the hydrolysis of the sn-2 position of membrane glycerophospholipids to liberate arachidonic acid (AA), a precursor of eicosanoids including prostaglandins and leukotrienes. The same reaction also produces lysophosholipids, which represent another class of lipid mediators.
The secretory PLA2 (sPLA2) family, in which 10 isozymes have been identified, consists of low molecular weight, Ca2+-requiring secretory enzymes that have been implicated in a number of biological processes, such as modification of eicosanoid generation, inflammation, and host defense.
This enzyme has been proposed to hydrolyze phosphatidylcholine (PC) in lipoproteins to liberate lyso- PC and free fatty acids in the arterial wall, thereby facilitating the accumulation of bioactive lipids and modified lipoproteins in atherosclerotic foci.
In mice, sPLA2 expression significantly influences HDL particle size and composition and demonstrate that an induction of sPLA2 is required for the decrease in plasma HDL cholesterol in response to inflammatory stimuli. Instillation of bacteria into the bronchi was associated with surfactant degradation and a decrease in large:small ratio of surfactant aggregates in rats.
Secreted Phospholipase A2-XII Human Recombiannt was produced with N-terminal His-Tag. sPLA2-XIIHis-Tagged Fusion Protein is 20.6 kDa containing 167 amino acid residues of the human secreted phospholipase A2-XII and 16 additional amino acid residues – His-Tag (underlined).
MRGSHHHHHHGMASHMQEQAQTTDWRATLKTIRNGVHKIDTYLNAALDLL
GGEDGLCQYKCSDGSKPFPRYGYKPSPPNGCGSPLFGVHLNIGIPSLTKCCNQ
HDRCYETCGKSKNDCDEEFQYCLSKICRDVQKTLGLTQHVQACETTVELLFD
SVIHLGCKPYLDSQRAACRCHYEEKTDL
Escherichia Coli.
Sterile Filtered lyophilized (freeze-dried) powder.
Sterile filtered and lyophilized from 0.5 mg/ml in 0.01M Tris buffer pH 8.6.
Add 0.2 ml of deionized water and let the lyophilized pellet dissolve completely.
Store lyophilized protein at -20°C. Aliquot the product after reconstitution to avoid repeated freezing/thawing cycles. Reconstituted protein can be stored at 4°C for a limited period of time; it does not show any change after two weeks at 4°C.
The lyophilized protein remains stable until the expiry date when stored at -20°C.
The amino acid sequence of the recombinant human Secreted Phospholipase A2-XII is 100% homologous to the amino acid sequence of the human Secreted Phospholipase A2-XII without signal sequence.
Ni-NTA affinity chromatography.
Greater than 95% as determined by SDS PAGE.
Western blotting
• Murakami M, Kudo I. New phospholipase A(2) isozymes with a potential role in atherosclerosis. Curr Opin Lipidol. 2003 Oct; 14(5): 431-6.
• Murakami M, Masuda S, Shimbara S, Bezzine S, Lazdunski M, Lambeau G, Gelb MH, Matsukura S, Kokubu F, Adachi M, Kudo I. Cellular arachidonate-releasing function of novel classes of secretory phospholipase A2s (groups III and XII). J Biol Chem. 2003 Mar; 278(12): 10657-67.
• Lindbom J, Ljungman AG, Lindahl M, Tagesson C. Increased gene expression of novel cytosolic and secretory phospholipase A(2) types in human airway epithelial cells induced by tumor necrosis factor-alpha and IFN-gamma. J Interferon Cytokine Res. 2002 Sep; 22(9): 947-55.
• Touqui L, Alaoui-El-Azher M. Mammalian secreted phospholipases A2 and their pathophysiological
significance in inflammatory diseases. Curr Mol Med. 2001 Dec; 1(6): 739-54. Review.
Prospec's products are furnished for LABORATORY RESEARCH USE ONLY. The product may not be used as drugs, agricultural or pesticidal products, food additives or household chemicals.
|
