ProSpec | Recombinant Protein Manufacturer
Search by name or Catalog #:
 
0 items|0 $
Protein Catalog
Cytokines
Growth Factors
Chemokines
CD Antigens
Neurotrophins
Hormones
Enzymes
Viral Antigens
Recombinant Proteins
Natural Proteins
Monoclonal Antibodies
Polyclonal Antibodies
Protein Catalog >> Viral Antigens >> EBV >> EBV p23, His
print send to friend add to favorites
Description
Our Price Quantity Shipping  
Epstein-Barr Virus (HHV-4) p23 Recombinant, His Tag
Ice Packs
Catalogue Number EBV-278
Introduction The Epstein-Barr virus (EBV), also called Human herpes virus 4 (HHV-4), is a virus of the herpes family (which includes Herpes simplex virus and Cytomegalovirus. On infecting the B-lymphocyte, the linear virus genome circularizes and the virus subsequently persists within the cell as an episome. The virus can execute several distinct programs of gene expression which can be broadly categorized as being lytic cycle or latent cycle. The lytic cycle or productive infection results in staged expression of a host of viral proteins with the ultimate objective of producing infectious virions. Formally, this phase of infection does not inevitably lead to lysis of the host cell as EBV virions are produced by budding from the infected cell. The latent cycle (lysogenic) programs are those that do not result in production of virions. A very limited, distinct set of viral proteins are produced during latent cycle infection. These include Epstein-Barr nuclear antigen (EBNA)-1, EBNA-2, EBNA-3A, EBNA-3B, EBNA-3C, EBNA-leader protein (EBNA-LP) and latent membrane proteins (LMP)-1, LMP-2A and LMP-2B and the Epstein-Barr encoded RNAs (EBERs).
Description The E.Coli derived recombinant protein contains the HHV-4 p23 regions, 10- C-end amino acids having a Mw of 17.7kDa.
Purification Method Purified by proprietary chromatographic technique.
Purity Protein is >95% pure as determined by 10% PAGE (coomassie staining).
Formulation 1xPBS pH-8 and 300mM Imidazole.
Storage EBV p23, His although stable at 4°C for 1 week, should be stored below -18°C.
Please prevent freeze thaw cycles.
Specificity Immunoreactive with sera of EBV-infected individuals.
Amino Acid Sequence SAPRKVRLPSVKAVDMSMEDMAARLARLESENKALKQ
QVLRGGACASSTSVPSAPVPPPEPLTARQREVMITQATG
RLASQAMKKIEDKVRKSVDGVTTRNEMENILQNLTLRIQ
VSMLGAKGQPSPGEGTRPRESNDPNATRRARSRSRGRE
AKKVQISD.
Applications Antigen in ELISA and Western blots, excellent antigen for detection of HHV-4 (EBV) with minimal specificity problems.
Usage ProSpec's products are furnished for LABORATORY RESEARCH USE ONLY. The product may not be used as drugs, agricultural or pesticidal products, food additives or household chemicals.
Related Products
» EBV EA
» EBV EBNA1
» EBV EBNA1, His
» EBV p18
» EBV p18 M
» EBV p18, GST
» EBV p23
Contact Us

Toll Free Phone: 1-(866)-245-0885
Toll Free Fax:  1-(866)-796-4944
Postal Address: PO Box 6591,
East Brunswick, 08816 NJ

Toll Free Phone: 00-800-800-66666
Toll Free Fax: 00-800-800-67890

International Phone: +972-8-9471175
International Fax: +972-8-9460534
Postal Address: PO Box 4157,
Ness-Ziona, 74140 Israel

Website : www.prospecbio.com
Email: info@prospecbio.com

 
  Home | Legal | Privacy | Site Map | Cytokines | Growth Factors | Chemokines | CD Antigens | Neurotrophins | Hormones | Enzymes | Recombinant Proteins | Viral Antigens | Monoclonal Antibodies