|
|
|
|
|
|
|
|
|
|
|
|
|
Catalogue Number
|
DEN-012
|
|
Introduction
|
Caused by one of four closely related virus serotypes of the genus Flavivirus, family Flaviviridae, each serotype is sufficiently different that there is no cross-protection and epidemics caused by multiple serotypes (hyperendemicity) can occur. In cell culture experiments and mice Morpholino antisense oligos have shown specific activity against Dengue virus.
|
|
Description
|
The E.coli derived recombinant 12kDa protein is genetically engineered peptide which is derived from Dengue Type-2 envelope III domain immunodeterminant regions. The expressed dengue envelope Type-2 III domain peptide has 100 amino acids covering domain III region from amino acids 300-400, and is fused with a 6 His Tag. This peptide is particularly important for diagnostic and vaccine development as it contains multiple serotypes, neutralizing epitopes and receptor binding domain.
|
|
Method
|
Purified by proprietary chromatographic technique.
|
|
Purity
|
Protein is >95% pure as determined by 10% PAGE (coomassie staining).
|
|
Formulation
|
50mM sodium chloride-phosphorous buffer, pH-7.4.
|
|
Storage
|
Dengue Envelope-ST4 D-III although stable at 4°C for 1 week, should be stored below -18°C. Please prevent freeze thaw cycles.
|
|
Applications
|
Each laboratory should determine an optimum working titer for use in its particular application.
|
|
Sequence
|
SYTMCSGKFSIDKEMAETQHGTTVVKVKYEGAGAPCKVPIEIRDVNKEKV VGRIISSTPFAEYTNSVTNIELEPFGDSYIVIGVGDSALTLHWFRKGSSIV.
|
|
Usage
|
ProSpec's products are furnished for LABORATORY RESEARCH USE ONLY. They may not be used as drugs, agricultural or pesticidal products, food additives or household chemicals.
|
|
Related Products
|
|
|
|
|
|
|
| Contact Us |
 |
Toll Free Phone: 1-(866)-245-0885 Toll Free Fax: 1-(866)-796-4944 Postal Address: PO Box 6591, East Brunswick, 08816 NJ |
 |
Toll Free Phone: 00-800-800-66666 Toll Free Fax: 00-800-800-67890 |
 |
International Phone: +972-8-9471175 International Fax: +972-8-9460534 Postal Address: PO Box 4157, Ness-Ziona, 74140 Israel
|
|
 |
Website : www.prospecbio.com Email: info@prospecbio.com |
|
|
|
|
|
|
|