ProSpec | Recombinant Protein Manufacturer
Search by name or Catalog #:
 
0 items|0 $
Protein Catalog
Cytokines
Growth Factors
Chemokines
CD Antigens
Neurotrophins
Hormones
Enzymes
Viral Antigens
Recombinant Proteins
Natural Proteins
Monoclonal Antibodies
Polyclonal Antibodies
Protein Catalog >> Viral Antigens >> Dengue >> Dengue Envelope-4 15kDa
print send to friend add to favorites
Description
Our Price Quantity Shipping  
Dengue Virus Subtype 4 Envelope 15kDa, C-Terminal (Domain III) Recombinant
Ice Packs
Catalogue Number DEN-012
Introduction Caused by one of four closely related virus serotypes of the genus Flavivirus, family Flaviviridae, each serotype is sufficiently different that there is no cross-protection and epidemics caused by multiple serotypes (hyperendemicity) can occur. In cell culture experiments and mice Morpholino antisense oligos have shown specific activity against Dengue virus.
Description The E.coli derived recombinant 12kDa protein is genetically engineered peptide which is derived from Dengue Type-2 envelope III domain immunodeterminant regions. The expressed dengue envelope Type-2 III domain peptide has 100 amino acids covering domain III region from amino acids 300-400, and is fused with a 6 His Tag. This peptide is particularly important for diagnostic and vaccine development as it contains multiple serotypes, neutralizing epitopes and receptor binding domain.
Method Purified by proprietary chromatographic technique.
Purity Protein is >95% pure as determined by 10% PAGE (coomassie staining).
Formulation 50mM sodium chloride-phosphorous buffer, pH-7.4.
Storage Dengue Envelope-ST4 D-III although stable at 4°C for 1 week, should be stored below -18°C.
Please prevent freeze thaw cycles.
Applications Each laboratory should determine an optimum working titer for use in its particular application.
Sequence SYTMCSGKFSIDKEMAETQHGTTVVKVKYEGAGAPCKVPIEIRDVNKEKV
VGRIISSTPFAEYTNSVTNIELEPFGDSYIVIGVGDSALTLHWFRKGSSIV.
Usage ProSpec's products are furnished for LABORATORY RESEARCH USE ONLY. They may not be used as drugs, agricultural or pesticidal products, food additives or household chemicals.
Related Products
» Dengue Envelope-1 15kDa
» Dengue Envelope-1 22kDa
» Dengue Envelope-2 15kDa
» Dengue Envelope-2 22kDa
» Dengue Envelope-3 15kDa
» Dengue Envelope-3 22kDa
» Dengue Envelope-4 22kDa
» Dengue type 2 Antibody
Contact Us

Toll Free Phone: 1-(866)-245-0885
Toll Free Fax:  1-(866)-796-4944
Postal Address: PO Box 6591,
East Brunswick, 08816 NJ

Toll Free Phone: 00-800-800-66666
Toll Free Fax: 00-800-800-67890

International Phone: +972-8-9471175
International Fax: +972-8-9460534
Postal Address: PO Box 4157,
Ness-Ziona, 74140 Israel

Website : www.prospecbio.com
Email: info@prospecbio.com

 
  Home | Legal | Privacy | Site Map | Cytokines | Growth Factors | Chemokines | CD Antigens | Neurotrophins | Hormones | Enzymes | Recombinant Proteins | Viral Antigens | Monoclonal Antibodies