ProSpec | Recombinant Protein Manufacturer
Search by name or Catalog #:
 
0 items|0 $
Protein Catalog
Cytokines
Growth Factors
Chemokines
CD Antigens
Neurotrophins
Hormones
Enzymes
Viral Antigens
Recombinant Proteins
Natural Proteins
Monoclonal Antibodies
Polyclonal Antibodies
Protein Catalog >> Enzymes >> Other >> Chitinase
print send to friend add to favorites
Description
Our Price Quantity Shipping  
Chitinase Clostridium Paraputrificum Recombinant
 
Catalogue Number ENZ-031
Introduction Chitinase is a digestive enzyme which breaks down glycosidic bonds in chitin. Due to chitin being a component of the cell walls of fungi and exoskeletal elements of some animals (including worms and arthropods), chitinases are usually found in organisms that either need to remake their own chitin or to dissolve and digest the chitin of fungi or animals. Chitinivorous organisms include many bacteria genuses such as Aeromonas, Bacillus, Vibrio, among others, which may be pathogenic or detritivorous. Chitinase expression is mediated by the NPR1 gene and the salicylic acid pathway, both of which are involved in resisting fungal and insect attack. Human chitinases appear in gastric juices. They are likely to be digestive chitinases, for catabolic activity. Chitinase activity is identified systemically in humans, in the blood, and possibly cartilage. Chitinase has been related to allergies, asthma in particular has been linked to enhanced chitinase expression levels, also dust mites and mold spores which are both chitin covered.
Description Chitinase Clostridium Paraputrificum Recombinant fused with a 13 amino acid His tag at N-terminus produced in E.Coli is a single, non-glycosylated, polypeptide chain containing 583 amino acids and having a molecular mass of 64.3kDa. The Chitinase is purified by proprietary chromatographic techniques.
Source Escherichia Coli.
Physical Appearance Sterile Filtered White lyophilized (freeze-dried) powder.
Formulation Chitinase lyophilized from a 0.2µm filtered concentrated solution in PBS.
Solubility It is recommended to reconstitute the lyophilized Chitinase in sterile 18MΩ-cm H2O not less than 100µg/ml, which can then be further diluted to other aqueous solutions.
Stability Lyophilized Chitinase although stable at room temperature for 3 weeks, should be stored desiccated below -18°C. Upon reconstitution Chitinase should be stored at 4°C between 2-7 days and for future use below -18°C.
For long term storage it is recommended to add a carrier protein (0.1% HSA or BSA).
Please prevent freeze-thaw cycles.
Purity Greater than 95.0% as determined by SDS-PAGE.
Amino acid sequence HMRGSGSHHHHHHMYYGDWSIWGGQGNFYPKDIPADKLTHLNFAFMDFNSSGEL
IYCDKDAAIGHPLGNLGVTYGDVNGGILNAFQVLKSENPNLKIGVSLGGWSKSG
DFSTIAATPSIRAKFVENVMKFIKYTNMDFVDIDWEYPGDYREPDKTDNINDEG
TPNASAGDKENYILLLQDLKEALNKQGKELGKVYELSVALPAGVSKIEKGIDVD
KLFNIVDFANIMTYDMAGAWSTTSGHQTALYTNPNAPEEYKGLSVDESVKYYIS
QGAEREKIVVGAAYYTRGWEQVSDKGTDPNNPGLFGEAAVVNKDADLSPTPGAL
NEAPMKNGEGGRAGGVWGYNALDKLKSKYTGLKEYWDDSAKAPYLYNSETGAFF
TYDNIRSIQEKAKYVKENNLGGIIGWMASQDATTNSTKRDELTTATKESLFGKE
DLPKYEIKYTENDITCTVTPVKQSWGSGGVLKMSITNNEKLDESGEVLSTVETS
AKTVKNMKVYIKTDGIAITGSQYPAGPVTKEGDYYVIDFGKISDGKLMKAGITF
TFDLNLDKAIEDTNNIISIEVSQRMYQTSPEFNRQTIWENTNS.
Usage ProSpec's products are furnished for LABORATORY RESEARCH USE ONLY. The product may not be used as drugs, agricultural or pesticidal products, food additives or household chemicals.
Related Products
Contact Us

Toll Free Phone: 1-(866)-245-0885
Toll Free Fax:  1-(866)-796-4944
Postal Address: PO Box 6591,
East Brunswick, 08816 NJ

Toll Free Phone: 00-800-800-66666
Toll Free Fax: 00-800-800-67890

International Phone: +972-8-9471175
International Fax: +972-8-9460534
Postal Address: PO Box 4157,
Ness-Ziona, 74140 Israel

Website : www.prospecbio.com
Email: info@prospecbio.com

 
  Home | Legal | Privacy | Site Map | Cytokines | Growth Factors | Chemokines | CD Antigens | Neurotrophins | Hormones | Enzymes | Recombinant Proteins | Viral Antigens | Monoclonal Antibodies