ProSpec | Recombinant Protein Manufacturer
Search by name or Catalog #:
 
0 items|0 $
Protein Catalog
Cytokines
Growth Factors
Chemokines
CD Antigens
Neurotrophins
Hormones
Enzymes
Viral Antigens
Recombinant Proteins
Natural Proteins
Monoclonal Antibodies
Polyclonal Antibodies
Protein Catalog >> Cytokines >> B-Cell Activating Factor >> BAFF R Human
Accession # print send to friend add to favorites
Description
Our Price Quantity Shipping  
B-cell Activating Factor Receptor Human Recombinant
 
Catalogue Number CYT-429
Synonyms TNFRSF13C, CD268, BAFF-R, MGC138235, B cell-activating factor receptor.
Introduction B cell-activating factor (BAFF) enhances B-cell survival in vitro and is a regulator of the peripheral B-cell population. Overexpression of Baff in mice results in mature B-cell hyperplasia and symptoms of systemic lupus erythematosus (SLE). Also, some SLE patients have increased levels of BAFF in serum. Therefore, it has been proposed that abnormally high levels of BAFF may contribute to the pathogenesis of autoimmune diseases by enhancing the survival of autoreactive B cells. The protein encoded by this gene is a receptor for BAFF and is a type III transmembrane protein containing a single extracellular cysteine-rich domain. It is thought that this receptor is the principal receptor required for BAFF-mediated mature B-cell survival.
Description B Lymphocyte Stimulator Receptor Human Recombinant extracellular produced in E.Coli is a single, non-glycosylated polypeptide chain containing 76 amino acids and having a molecular mass of 7.7 kDa.
The BAFF-R is purified by proprietary chromatographic techniques.
Source Escherichia Coli.
Physical Appearance Sterile Filtered White lyophilized (freeze-dried) powder.
Formulation Lyophilized from a 0.2μm filtered concentrated (1.0mg/ml) solution in 20mM PB, pH 8.0, 500mM NaCl.
Solubility It is recommended to reconstitute the lyophilized B Lymphocyte Stimulator Receptor Recombinant in sterile 18MΩ-cm H2O not less than 100µg/ml, which can then be further diluted to other aqueous solutions.
Stability Lyophilized BAFF-R although stable at room temperature for 3 weeks, should be stored desiccated below -18°C. Upon reconstitution B Lymphocyte Stimulator Receptor should be stored at 4°C between 2-7 days and for future use below -18°C.
Please prevent freeze-thaw cycles.
Amino Acid Sequence MRRGPRSLRGRDAPAPTPCVPAECFDLLVRHCVACGLLRTPRPKPAG
ASSPAPRTALQPQESVGAGAGEAALPLPG.
Purity Greater than 95.0% as determined by(a) Analysis by RP-HPLC.
(b) Analysis by SDS-PAGE.
Biological Activity Determined by its ability to block BAFF induced mouse splenocyte survival. The expected ED50 for this effect is 1000-5000ng/ml corresponding to a Specific Activity of 200-1000IU/mg in the presence of 1.0?g/ml of human soluble BAFF.
Usage ProSpec's products are furnished for LABORATORY RESEARCH USE ONLY. The product may not be used as drugs, agricultural or pesticidal products, food additives or household chemicals.
Related Products
» BAFF Human
» BAFF Human, His
Contact Us

Toll Free Phone: 1-(866)-245-0885
Toll Free Fax:  1-(866)-796-4944
Postal Address: PO Box 6591,
East Brunswick, 08816 NJ

Toll Free Phone: 00-800-800-66666
Toll Free Fax: 00-800-800-67890

International Phone: +972-8-9471175
International Fax: +972-8-9460534
Postal Address: PO Box 4157,
Ness-Ziona, 74140 Israel

Website : www.prospecbio.com
Email: info@prospecbio.com

 
  Home | Legal | Privacy | Site Map | Cytokines | Growth Factors | Chemokines | CD Antigens | Neurotrophins | Hormones | Enzymes | Recombinant Proteins | Viral Antigens | Monoclonal Antibodies