ProSpec | Recombinant Protein Manufacturer
Search by name or Catalog #:
 
0 items|0 $
Protein Catalog
Cytokines
Growth Factors
Chemokines
CD Antigens
Neurotrophins
Hormones
Enzymes
Viral Antigens
Recombinant Proteins
Natural Proteins
Monoclonal Antibodies
Polyclonal Antibodies
Protein Catalog >> Cytokines >> Adiponectin >> Acrp30 Human
Accession # print send to friend add to favorites
Description
Our Price Quantity Shipping  
Adiponectin Human Recombinant
Ice Packs
Catalogue Number CYT-280
Synonyms Acrp30, AdipoQ, GBP-28, APM-1, ACDC.
Introduction The adipose tissue exclusively expresses and secretes Adiponectin (Acrp30). Acrp30 is involved in various physiological processes such as energy homeostasis, insulin sensitivity, hormonal processes, fatty acid metabolism and obesity.
Adiponectin circulates in the plasma. Decreased levels of Adiponectin are associated with insulin resistance and hyperinsulinemia, as seen in people with obesity insulin resistance, and diabetes type 2, whose plasma levels of adiponectin are reduced.
The modular structure of Acrp30 is comprised of N-terminal collagenous domain followed by a C-terminal globular domain.
Acrp30 also acts as a significant negative regulator in hematopoiesis and immune systems; it may be involved in ending inflammatory responses through its inhibitory functions. Adiponectin inhibits endothelial NF-kappa-b signaling through a cAMP-dependent pathway, it also inhibits TNF-alpha- induced expression of endothelial adhesion molecules.
Patent Rights

The sale and/or commercial use of Recombinant Adiponectin is prohibited in the United States of America (U.S.A).

Description The Adiponectin Human recombinant protein is a single, non-glycosilated polypeptide chain produced in E. coli, having a molecular weight of 25.1 kDa and containing 231 amino acids (15-244).
Amino Acid Sequence MGHDQETTTQGPGVLLPLPKGACTGWMAGIPGHPGHNGAPGRDGRDGTPGE
KGEKGDPGLIGPKGDIGETGVPGAEGPRGFPGIQGRKGEPGEGAYVYRSAFSV
GLETYVTIPNMPIRFTKIFYNQQNHYDGSTGKFHCNIPGLYYFAYHITVYMKD
VKVSLFKKDKAMLFTYDQYQENNVDQASGSVLLHLEVGDQVWLQVYGEGE
RNGLYADNDNDSTFTGFLLYHDTN.
Source Escherichia Coli.
Formulation Acrp30 is liquid 1mg/ml in PBS, pH 7.4 containing 1 mM DTT.
Storage Store Acrp30 at -20°C. Can be stored at 4°C for a limited period of time of 7 days.
Purity Acrp30 purity is greater than 90% as determined by SDS-PAGE.
Usage ProSpec's products are furnished for LABORATORY RESEARCH USE ONLY. The product may not be used as drugs, agricultural or pesticidal products, food additives or household chemicals.
Related Products
» Acrp30 Antibody
» Acrp30 Human
» Acrp30 Human, HEK
» Acrp30 Human, His
» Acrp30 Human, Trimeric
» Acrp30 Mouse, HEK
» Acrp30 Mouse, His
» Acrp30 Mouse, Trimeric
» gAcrp30 Human
» gAcrp30 Human, His
» gAcrp30 Mouse
Contact Us

Toll Free Phone: 1-(866)-245-0885
Toll Free Fax:  1-(866)-796-4944
Postal Address: PO Box 6591,
East Brunswick, 08816 NJ

Toll Free Phone: 00-800-800-66666
Toll Free Fax: 00-800-800-67890

International Phone: +972-8-9471175
International Fax: +972-8-9460534
Postal Address: PO Box 4157,
Ness-Ziona, 74140 Israel

Website : www.prospecbio.com
Email: info@prospecbio.com

 
  Home | Legal | Privacy | Site Map | Cytokines | Growth Factors | Chemokines | CD Antigens | Neurotrophins | Hormones | Enzymes | Recombinant Proteins | Viral Antigens | Monoclonal Antibodies